(data stored in ACNUC7421 zone)

EMBL: CP002343.PE245

CP002343.PE245       Location/Qualifiers
FT   CDS_pept        270237..271715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0250"
FT                   /product="catalytic domain-containing protein of components
FT                   of various dehydrogenase complexes"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR000089: IPR004167: IPR001078; KEGG:
FT                   kse:Ksed_02370 pyruvate/2-oxoglutarate dehydrogenase
FT                   complex, dihydrolipoamide acyltransferase component; PFAM:
FT                   catalytic domain-containing protein of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein; SPTR:
FT                   Putative dihydrolipoamide acyltransferase component; PFAM:
FT                   2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); e3 binding domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46807"
FT                   /db_xref="GOA:E6S6S1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S1"
FT                   /protein_id="ADU46807.1"
FT                   /translation="MAIRTFNLPDPGEGLVEAEIVEWKVAPGDTVKVNDMVLEIETAKS
FT                   LVELPIPWSGTVRELLVNVGDTVDVGTPIISIDDGQGGDAPAAPAGETAQAPKGEQQEA
FT                   NLVGYGAKAGATARRARKQGDGRMPLGSVPESAPARAAAPTETEQVAEAEPVAEQTAPA
FT                   PRTESPAPAVEPVAREGRPKAKPPVRKLAKDLGVDLWSVPGSGPDGIITRDDVESFARG
FT                   VNLPERQGVSDQGEAAASVSAAPSPAAYPFGSGEREVRTPIKGVRKMTAQAMVGSAFTA
FT                   PHVTEWVTVDVTRTMELVDRLKRSREFKDVKVTPLLVLARAMILAIRRNPGVNATWDEA
FT                   AQEIVQKNYVNLGIAAATPRGLIVPNIKDAHGMSMLQLAQAIGELTATAREGRTQPAEM
FT                   SGGTITITNVGVFGVDSGTPIINPGESAIVAFGAIRKMPWVVEGPAGDEIVVRHVTQLA
FT                   MSFDHRLVDGELGSRFLADLAAIMADPGQALVWG"
     gtggcaattc gcacgttcaa cctgcccgac cccggtgagg gtctcgtcga ggccgagatc        60
     gtcgagtgga aggtcgctcc cggcgacacc gtgaaggtca acgacatggt cctcgagatc       120
     gagacggcca agtcgctcgt cgagctgccg atcccgtggt ccggcaccgt gagggagctc       180
     ctcgtcaacg tcggcgacac cgtcgacgtc ggcacgccga tcatcagcat cgacgacggt       240
     cagggtggcg acgccccggc cgcgccggcg ggtgagacgg cccaggcgcc gaagggggag       300
     cagcaggagg ccaatctcgt cggctacgga gccaaggccg gagcgaccgc tcgccgcgct       360
     cgcaagcagg gggatggccg tatgccgctg ggctcggtcc ccgagtcggc gccggcacgc       420
     gcggcggcac ccaccgagac ggagcaggtt gccgaggccg agccggtcgc cgagcagacc       480
     gccccggctc cgcgcaccga gtccccggca cccgccgtcg agccggtggc ccgagaaggc       540
     cgtcccaagg cgaagccccc ggtccgcaag ctcgccaagg acctgggtgt cgatctctgg       600
     tcggtgccgg gctccggccc cgacggcatc atcacccgcg acgacgtcga gtccttcgcg       660
     cgcggcgtca acctccctga acggcagggc gtttcggacc agggcgaggc ggcggccagc       720
     gtctccgcgg caccgagccc agcggcatac cccttcggct cgggcgagcg ggaggtgcgg       780
     accccgatca agggcgtgcg caagatgacc gcgcaggcga tggtcgggtc cgcgttcacc       840
     gcgccgcacg tcaccgagtg ggtcaccgtc gacgtgacca ggacgatgga gctcgtcgac       900
     cggctcaagc ggtcgcgtga gttcaaggac gtcaaggtca cgccgctgct cgttctcgcc       960
     agggcgatga tcctcgcgat caggcgcaac cccggcgtca acgcgacgtg ggacgaggcg      1020
     gcgcaggaga tcgtccagaa gaactacgtc aacctcggga tcgccgcggc caccccgcga      1080
     gggctgatcg tcccgaacat caaggacgcc cacggcatgt cgatgctcca gctcgcgcag      1140
     gccatcggcg aactgacggc gacggcgcgg gaggggcgga cgcagccggc ggagatgtcg      1200
     ggcggcacga tcaccatcac caacgtcggc gtcttcggcg tcgacagcgg caccccgatc      1260
     atcaacccgg gcgagtcggc gatcgtcgcg ttcggtgcga tccgcaagat gccgtgggtc      1320
     gtcgagggcc cggccggcga cgagatcgtg gtccggcacg tgacgcagct ggcgatgagc      1380
     ttcgaccacc ggctcgtcga cggcgagctg gggtcgcgct tcctggctga cctcgcggcg      1440
     atcatggcgg acccgggcca ggccctggtc tggggctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page