(data stored in ACNUC7421 zone)

EMBL: CP002343.PE247

CP002343.PE247       Location/Qualifiers
FT   CDS_pept        275478..276071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0253"
FT                   /product="regulatory protein TetR"
FT                   /note="InterPro IPR001647; KEGG: fra:Francci3_0716 TetR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: Transcriptional regulator, TetR family; PFAM:
FT                   Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46809"
FT                   /db_xref="GOA:E6S6S3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S3"
FT                   /protein_id="ADU46809.1"
FT                   /translation="MSEPDCGLRERKKRETRMAIHRAALDLVEEAGFDAVTTDQIAARA
FT                   GVSPRTLFNYFPTKESAVLGATPADLDEMRALLDARPASEPILQSIRAIVEARLSPTTY
FT                   DPQLRAQRRRVILSEPSLGPALVGNNIRAENVLTELVADRLGLDPRESVRPRVTVASAL
FT                   AAVRACIEHQHSGGSGTVEEAVDEAFLLLEHGFA"
     atgagcgagc cggactgtgg actgcgtgag cgcaagaagc gtgagacgcg gatggcgatc        60
     caccgcgcag ccctggacct cgtcgaggag gccggcttcg acgccgtgac gaccgaccag       120
     atcgcggctc gtgccggggt gagcccgcgc accttgttca actacttccc gaccaaggag       180
     agcgccgtcc tcggcgcgac cccggccgac ctcgacgaga tgcgggccct gctcgatgcc       240
     cggccggcga gcgagccgat cctccagtcg atccgggcca tcgtcgaggc acgcctctcc       300
     ccgacgacgt acgacccgca gctgcgcgcg cagcgacggc gggtcatcct cagtgagccg       360
     tccctcgggc cggcgctggt gggcaacaac atccgggcgg agaacgtcct cacggagctc       420
     gtcgccgacc ggctcggcct cgacccgcgc gagtcagtgc ggccacgcgt cactgtcgcg       480
     agcgccctcg ccgcggtccg ggcgtgcatc gagcaccagc actccggggg gagcggcacc       540
     gtcgaggagg cggtggacga ggccttcctc ctcctcgagc acggcttcgc ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page