(data stored in ACNUC7421 zone)

EMBL: CP002343.PE250

CP002343.PE250       Location/Qualifiers
FT   CDS_pept        278024..279340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0256"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="COGs: COG1914 Mn2+ and Fe2+ transporter of the NRAMP
FT                   family; InterPro IPR001046; KEGG: aau:AAur_pTC10168
FT                   H(+)-stimulated manganese uptake protein; PFAM: natural
FT                   resistance-associated macrophage protein; SPTR: Mn2+/Fe2+
FT                   transporter, NRAMP family; PFAM: Natural
FT                   resistance-associated macrophage protein; TIGRFAM: NRAMP
FT                   (natural resistance-associated macrophage protein) metal
FT                   ion transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46812"
FT                   /db_xref="GOA:E6S6S6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S6"
FT                   /protein_id="ADU46812.1"
FT                   /translation="MWLSELARRVPVAHALTMGDRPGRALPSHVDARSPEHGLGGTLRA
FT                   PRTLVPALLAAIAYVDPGNFGVNITSGAEHGYALVWVVVFASCAAMVIQYLAAKLGMVT
FT                   GLSLAEHSARRYPGVGRIVLWTQAEIVVIMTDLAEIVGGAIALYLLFGMPLMWGAVAVT
FT                   GFSLVVLYLKVHGRSHFESVVLVLLAVIIGSLLWQVLVAEVDRVALLRSAVPGPLDSSA
FT                   ALLAVGIVGATVMPHALHFHSAASRTRDDGQVEPSQAVRLRIGRQTVRSVVIAMTVAGA
FT                   ANISLVVFAAALPSEAGASIETAYAALGAEAGQIAATMLAVALLASGLASTLVGVQTGD
FT                   VVMTGFGRRPIPALLRRTLAVVPALIILGLGVEPTLALVWSQVILSFALPGTLIPLLLF
FT                   THDRRLMGAMANHRLTTAVAWIITAVIVGLVGFLLVSGA"
     atgtggttgt ccgagttggc gcgacgggtc cctgtggccc atgctctgac catgggtgac        60
     cgaccgggcc gcgcgctgcc gtcgcacgtc gacgcgcgct cccccgagca cgggctcggc       120
     gggaccttgc gtgcgcctcg gacgctcgtg cccgcgctcc tcgcggcgat cgcctacgtc       180
     gaccccggca acttcggggt caacatcacg tccggcgccg agcacgggta cgcgctcgtg       240
     tgggtcgtcg tgttcgccag ctgtgcggcg atggtgatcc agtacctcgc tgccaagctc       300
     gggatggtca ccggcctcag cctcgccgag cacagtgccc ggcggtaccc gggcgtcggg       360
     cgcatcgtgc tgtggaccca ggccgagatc gtcgtcatca tgaccgacct cgccgagatc       420
     gtcggcggtg cgatcgcgct gtacctcctc ttcgggatgc cgctcatgtg gggcgcggtc       480
     gcggtgaccg ggttcagcct cgtcgtcctc tacctcaagg tgcacgggcg cagccacttc       540
     gagtccgtgg tcctggtcct gctcgccgtc atcatcggct cgctcctctg gcaggtgctc       600
     gtcgccgagg tcgaccgggt ggcgctgctg cggtcggcgg tgcccggccc gctggactcg       660
     tcggcggcgc tgctcgccgt cggcatcgtc ggcgcgaccg tcatgcccca cgccctgcac       720
     ttccactccg cggcgtcgcg gacccgcgac gacggccagg tcgagccctc gcaggccgtc       780
     cgcctgcgga tcgggcggca gacagtgcgc tccgtcgtca tcgcgatgac cgtggcgggc       840
     gcggccaaca tcagtctcgt cgtcttcgcc gcggccctgc cgagcgaggc gggcgcgagc       900
     atcgagaccg cctacgcggc cctgggggcg gaggcagggc agatcgcggc cacgatgctc       960
     gcggtggcgc tgctcgcctc gggtctcgcg tcgaccctcg tcggcgtgca gaccggggac      1020
     gtcgtcatga ccggcttcgg caggcggccg atccctgccc tgctgcggcg caccctcgcc      1080
     gtggtgcccg cgctcatcat cctcgggctc ggggtcgagc cgaccctcgc gctcgtgtgg      1140
     agccaggtca tcctgtcgtt cgcgctcccc gggacactca tcccgctcct cctcttcacg      1200
     cacgaccggc ggctcatggg cgccatggcc aaccaccggc tgaccacggc ggtggcctgg      1260
     atcatcaccg ccgtcatcgt cgggctggtc gggttcctcc tggtcagcgg cgcctga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page