(data stored in ACNUC7421 zone)

EMBL: CP002343.PE252

CP002343.PE252       Location/Qualifiers
FT   CDS_pept        280762..281820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0258"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006090; KEGG: mgi:Mflv_5167 acyl-CoA dehydrogenase
FT                   domain-containing protein; PFAM: acyl-CoA dehydrogenase
FT                   domain-containing protein; SPTR: Acyl-CoA dehydrogenase
FT                   domain protein; PFAM: Acyl-CoA dehydrogenase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46814"
FT                   /db_xref="GOA:E6S6S8"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6S8"
FT                   /protein_id="ADU46814.1"
FT                   /translation="MAELEHLARSTSADPDLVAMLTDLFATYRSTRPAPTELLDLDLGL
FT                   WAQLDELGLTRLTASEASGGSGASWVEGSALLGLAAAAGAPVPLVEHGMLGAWLLEEAG
FT                   LPNDGALRTVCRPDPSGRALNVTFARDSASIVALWEDADRWRVADVPTERVGLTQSRNL
FT                   AGEPCDTVEFELVDLASAPFVDDSVGHQFHLRGALARSAQVCGAMERVLEVVLTHTRER
FT                   EQFGRPIGRFQAVQHLVADIATESSLARAATDTAVARAAASQWQDPGMLFAVGVAKSCV
FT                   GHAASVVVRNAHQVLGAIGTTLEHELHVLTKPILVRRSEYGSVHEWDETLAELAASAGR
FT                   DRLWPLILTGRR"
     atggccgagc tcgagcacct cgccaggtcc accagcgccg accccgatct cgtcgcgatg        60
     ttgacggacc tcttcgccac gtaccgatcg accaggccgg cgcccaccga gctcctcgac       120
     ctcgacctcg gactgtgggc ccagctcgac gagctcggcc tgacgaggct caccgcgtcc       180
     gaggcgagcg ggggcagcgg cgcgagctgg gtcgaggggt ccgccctcct cgggctcgcc       240
     gcagcggcag gggcgccggt cccgctcgtc gagcacggga tgctcggcgc gtggctgctc       300
     gaggaggccg gcctgcccaa cgacggggcc ctgcggaccg tgtgccgccc ggacccctcg       360
     gggcgggccc tcaacgtcac cttcgcccgg gactccgcgt cgatcgtggc gctctgggag       420
     gacgcggacc gctggcgggt ggccgacgtc ccgacggagc gagtcggcct gacccagtcc       480
     cgcaacctcg ccggagagcc ctgcgacacg gtggagttcg agctcgtcga cctcgcgtcc       540
     gcgcccttcg tggacgactc ggtcggccac cagttccacc tccgaggggc gctggcccgc       600
     tcggcgcagg tgtgcggagc gatggagcgg gtcctcgagg tcgtcctcac ccacacccgc       660
     gagcgggagc agttcggccg gcccatcggc cggttccagg cggtccagca cctcgtggcc       720
     gacatcgcca cggagtcgtc gctggcccgc gccgcgaccg acacggcggt ggcccgggcg       780
     gcggcctcgc agtggcagga ccccggcatg ctcttcgccg tcggggtggc caagtcctgc       840
     gtgggccatg cggcctcggt cgtcgtgcgc aacgcccacc aggtcctcgg ggccatcggc       900
     acgactctcg agcacgagct ccacgtcctc accaagccga tcctcgtccg gcgcagcgag       960
     tacggctcgg tgcacgagtg ggacgagacg ctcgccgagc tcgcggcctc cgccggacgc      1020
     gaccgcctgt ggccgctcat cctcaccggc cgacgctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page