(data stored in SCRATCH zone)

EMBL: CP002343.PE255

CP002343.PE255       Location/Qualifiers
FT   CDS_pept        284145..284882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0261"
FT                   /product="ANTAR domain protein"
FT                   /note="InterPro IPR003018: IPR005561: IPR012074; KEGG:
FT                   rop:ROP_10100 hypothetical protein; PFAM: ANTAR domain
FT                   protein; GAF domain protein; SMART: GAF domain protein;
FT                   SPTR: Putative uncharacterized protein; PFAM: ANTAR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46817"
FT                   /db_xref="GOA:E6S6T1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T1"
FT                   /protein_id="ADU46817.1"
FT                   /translation="MSEHLPADQGTRDVFVRLSALIYAGADEADVYQTIVDAARRLVDG
FT                   CERASIMLKRRDRFVTAASTDDIARLADQIEREVREGPCYDAVLDEAYQHDTDLTSGTS
FT                   PWPRFTERVLAETPVRSAIGYRLFLDGDKVGALNLFADEPGALTERSADQGAVLASFAS
FT                   VALMAVRAREEAATLRLGLQSNREIGKAVGLLMAAHHMGSEQAFGVLRRTSQELNMKLT
FT                   QVAEEVVRGQEQQFGSTSSDGQG"
     atgagcgagc acctgccggc cgaccaaggc actcgcgacg tcttcgtgcg gctgtccgca        60
     ctcatctacg ccggggcgga cgaggccgac gtctaccaga cgatcgtcga tgcggcgcga       120
     cggctcgtcg acgggtgcga gcgagcctcg atcatgctca agcggcggga ccggttcgtg       180
     accgccgcgt cgaccgacga catcgcccgg ctcgcggacc agatcgagcg ggaggtccgc       240
     gagggcccct gctacgacgc ggttctcgac gaggcctacc agcacgacac cgacctcacg       300
     tcggggacca gcccgtggcc ccggttcacc gagcgggtcc tcgccgagac cccggtgcgg       360
     tcggccatcg gctaccgact cttcctcgac ggcgacaagg tcggggcgct caacctcttc       420
     gccgacgagc cgggcgcgct caccgagcgc tccgccgacc agggcgcggt cctggcctcg       480
     ttcgcgtcgg tggccctgat ggccgtccga gcgcgtgaag aggcggcgac gctccgcctc       540
     ggtctccaga gcaaccgtga gatcggcaag gccgtggggc tgctcatggc ggcgcaccac       600
     atgggttccg agcaggcctt cggcgtgctc cggcggacgt cccaggagct gaacatgaag       660
     ctgacccagg tcgccgagga ggtggtccga gggcaggagc agcagttcgg cagcacgtcc       720
     tcggacgggc agggatga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page