(data stored in ACNUC7421 zone)

EMBL: CP002343.PE257

CP002343.PE257       Location/Qualifiers
FT   CDS_pept        285869..287905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0263"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="COGs: COG3336 membrane protein; InterPro IPR019108;
FT                   KEGG: kse:Ksed_26540 predicted membrane protein; PFAM:
FT                   Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related; SPTR: Putative uncharacterized protein; PFAM:
FT                   Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG);
FT                   Copper resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46819"
FT                   /db_xref="GOA:E6S6T3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T3"
FT                   /protein_id="ADU46819.1"
FT                   /translation="MPSAARDVAVGRSVLPWAVALAVVAGLAASVLAAVFSGAVAAPPA
FT                   GLTDAGPVVRWALPLVRVVHDVAAALTVGALLLAATMIPGPTRAASAALEEPRRAAAFR
FT                   VATAAAFVWASAGAVGVVFTFADAAGLPLDHPAFAAELLRSVWSIDTLRVELISTMAAF
FT                   IVASFASLGRARSVAVALVVLAVLGVVVLGLTGHAGGSADHETAVNALAVHLLSATLWT
FT                   GGLLALILLRGALGDALAVVARRYSSVALWAFVALGVSGVMAASTRFARVEDLTSPYGV
FT                   LVLLKAGAFIVLGFAGWWHRRVTIHALERERAESRPGWAFLRLAIGEIVVMGVAFGLAT
FT                   ALARTQPPVPETVANPSAALALTGFPEPPSPTALSWVTAWRVEWLFLATALLAIGLYVA
FT                   GVVRLARRGDRWPVLRTVSWVAGWLVFIWATNGALGIYGRVAFSWHMTLHMVEAMVVPI
FT                   FLVLGAPVTLALRSLRARLDGTLGPRELLLGLVHSPYLKVVGNPIFAAAFFFMSLVVFY
FT                   WTDLFYLALTTHTGHLIMTAHFLIAGYLFAWVLVGSDPGPAKWSPALRLIVLFATIAFH
FT                   AFFGVAMISGTAVLAPDFFTAIDLSWVDDPLADQRNGGAVAWAIGELPSLALALLVAVQ
FT                   WSRTDKAEGRRRDRHADRDGDAELTAYNEHLARLARHDERPRP"
     atgccctcag ccgcccgtga cgtcgccgtg ggtcgttccg tgctgccgtg ggccgtcgct        60
     ctggccgtcg tggccggact cgccgccagc gtgctcgccg cagtcttcag cggcgccgtc       120
     gcagcgccac cggccggcct caccgacgcg ggtcccgtgg tgcgctgggc cctgcccctg       180
     gtccgggtcg tccatgacgt cgcggcggcc ctcaccgtgg gcgcgctgct gctggccgcg       240
     acgatgatcc ccggtcccac acgggccgcg tctgcggcgc tcgaggagcc ccgtcgggcc       300
     gcggccttcc gggtcgcgac ggcggcggcg ttcgtctggg ccagcgccgg cgcggtcggc       360
     gtggtcttca cgttcgccga tgcggcgggg ctcccgctcg accacccggc cttcgctgcc       420
     gagctgctcc gctccgtgtg gtccatcgac acgctgcggg tcgagctgat ctcgacgatg       480
     gcggccttca tcgtcgcctc cttcgcctcg ctcggtcgcg cccggtcggt ggctgtggcg       540
     ctggtggtcc tcgccgtcct cggcgtcgtc gtgctcggac tgaccggcca cgccggcggg       600
     tccgcggacc acgagaccgc ggtcaacgcc ctcgcggtgc acctgctcag cgccaccctc       660
     tggaccggtg gtctgctcgc cctcatcctg ctccggggtg cccttggtga tgccctcgcc       720
     gtggtggccc ggcgctactc gtccgtggcg ctctgggcct tcgtggcgtt gggcgtctcc       780
     ggggtgatgg ccgcctcgac gcggttcgcc cgagtggagg acctgacgtc cccctacggc       840
     gtcctcgtgc tgctcaaggc cggggcgttc atcgtgctcg gcttcgcggg ctggtggcac       900
     cggcgcgtca cgatccatgc cctcgagcgg gagcgcgccg agtcccgtcc gggctgggcc       960
     ttcctccgtc tggcgatcgg cgagatcgtc gtcatgggtg tggcgttcgg cctcgccacg      1020
     gccctggccc ggacccagcc gcctgtcccc gagaccgtcg cgaaccccag tgccgccctc      1080
     gcgctgaccg gcttccccga gccgccgtcc cccaccgccc tctcctgggt gaccgcctgg      1140
     cgggtcgagt ggctcttcct cgccacggcg ctgctcgcga tcggcctcta cgtcgccggt      1200
     gtggtccgac tggcccgccg aggggaccgg tggccggtgc tgcgcaccgt gagctgggtc      1260
     gcgggctggc tcgtcttcat ctgggcgacg aacggcgcgc tcgggatcta cgggcgggtc      1320
     gccttctcct ggcacatgac tctccacatg gtcgaggcca tggtcgtgcc gatcttcctc      1380
     gtgctcggcg ccccggtgac cctcgcgctg cgcagcctcc gggcccggct ggacgggacc      1440
     ctcggtcccc gcgagctcct cctgggcctc gtccactcgc cgtacctcaa ggtcgtcggc      1500
     aaccccatct tcgcggcggc gttcttcttc atgagcctcg tcgttttcta ctggacggac      1560
     ctgttctacc tggccctgac gacccacacc gggcacctca tcatgaccgc gcacttcctc      1620
     atcgcgggct acctcttcgc ctgggtgctc gtcggctcgg accccggccc ggcgaagtgg      1680
     agcccggccc tgcggctcat cgtgctgttc gcgacgatcg ccttccacgc gttcttcggg      1740
     gtcgcgatga tcagcggcac ggccgtgctg gctccagact tcttcacggc gatcgacctg      1800
     tcctgggtcg acgacccgtt ggccgaccag cgcaacggcg gagcggtggc gtgggccatc      1860
     ggcgagctcc cgtccctcgc gctcgccctc ctcgtcgccg tccagtggtc ccggaccgac      1920
     aaggcggagg ggcgccgacg ggaccggcac gccgaccgtg acggcgacgc cgagctgacg      1980
     gcctacaacg agcacctggc ccgcctggcc cggcacgacg agcggccccg cccctga         2037
//

If you have problems or comments...

PBIL Back to PBIL home page