(data stored in ACNUC7421 zone)

EMBL: CP002343.PE258

CP002343.PE258       Location/Qualifiers
FT   CDS_pept        288118..288303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfr:PFREUD_12670 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46820"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T4"
FT                   /protein_id="ADU46820.1"
FT                   /translation="MAGVPTPKCPIRIGEPCTLCFPGASGPQDCGLVYLVQSDDEWRDQ
FT                   LADKRREVRAGGTLAS"
     atggccggtg tgcccacgcc caagtgtccg atccggatcg gcgagccgtg caccctgtgc        60
     ttccccgggg cgagcggacc ccaggactgc ggcctcgtct acctcgtcca gtccgacgac       120
     gagtggcgcg accagctcgc cgacaagcgg cgcgaggtcc gggccggcgg caccctcgcc       180
     agctga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page