(data stored in ACNUC7421 zone)

EMBL: CP002343.PE261

CP002343.PE261       Location/Qualifiers
FT   CDS_pept        291308..291589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_2351 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46823"
FT                   /db_xref="GOA:E6S6T7"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T7"
FT                   /protein_id="ADU46823.1"
FT                   /translation="MGIGLGITLLVLGAILTFTGLDENILNYNLDTVGIILMVGGALAL
FT                   IMGIIQNAQRTRHTTVTEHRGAPEVVERRGPDVVERRDEIIDRRDERY"
     atgggtatcg gactcggtat cacgttgctg gttctcgggg cgatcctgac gttcaccgga        60
     ctcgacgaga acatcctcaa ctacaacctc gacaccgtgg ggatcatcct catggtgggt       120
     ggcgcactcg ccctcatcat gggcatcatc cagaacgccc agcgcacgcg gcacaccacg       180
     gtcaccgagc accgcggagc gcccgaggtc gtcgagcgtc gcggcccgga cgtcgtcgag       240
     cgtcgcgacg agatcatcga ccgccgggac gagcggtact ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page