(data stored in ACNUC7421 zone)

EMBL: CP002343.PE262

CP002343.PE262       Location/Qualifiers
FT   CDS_pept        291682..293070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4358 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46824"
FT                   /db_xref="GOA:E6S6T8"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6T8"
FT                   /protein_id="ADU46824.1"
FT                   /translation="MTTRSTTASPDPAAQAAAATPAHRDRWVDALRAGSLLVVVLGHWL
FT                   MVGLTPGGEITNALTEVPALQPLTWFLQVMPIFFLVGGVAHSYALESLDRRVAPGTPGR
FT                   YATFFRGRAVRLLRPTLAFLALWVALGVVAHVTGLTARPGTVGRFARDALVGVPQLLWF
FT                   VGIYLGACALAPVMRTFHERWGPYAAGLLAGAAVLVDVVRFNAVGLAGNLNFALVWLAF
FT                   HQLGFLWRDDRLTPRVGWLMVVAGYAGMLVAVTVGPYPTSMVGLPGEPVSNMAPPTVAL
FT                   LAQGIGICGLAVVARPVMNRVLRRPRAWLVVVRAAPFAMTAFLWHLTALMVVLVTLWAL
FT                   GVEQPAVASWRWWLTRPLLFAVLLVVTAVVVAVFVRFDRGPRTASDVPTTAARRSDVAA
FT                   ALSAVLVFFGILMVSIVGVDVLGSRPVFFLLGEVTPVVGLGVLAAGLAVLPGASRAWWH
FT                   RAAG"
     gtgacgaccc gttccacgac ggcctcaccc gacccggccg cgcaggctgc cgcggcgacc        60
     cccgcgcacc gggatcgctg ggtcgacgcc ctgcgggccg gctccctgct cgtggtggtc       120
     ctcggtcact ggctcatggt gggtctcacg ccggggggcg agatcaccaa cgcgctcacc       180
     gaggtgcccg ccctgcagcc gctgacgtgg ttcctccagg tcatgccgat cttcttcctc       240
     gtcggtggcg tggctcactc gtacgcgctg gagtcgctcg accgccgcgt ggcgccgggt       300
     acgccgggcc gctacgcgac gttcttccgg ggccgggcgg tgcgcctcct tcgtccgacg       360
     ctcgcgttcc tcgcgctctg ggtcgcgctc ggtgtcgtcg cccacgtgac cggactgacg       420
     gcgcggccgg ggaccgtcgg gcggttcgcc cgcgatgccc tcgttggcgt gccgcagctg       480
     ctgtggttcg tcggcatcta cctgggggcg tgcgcgctcg ctccggtgat gcggacgttc       540
     catgaacgat gggggccgta tgccgctggg ctcctcgccg gggcggctgt cctcgtggac       600
     gtggtccggt tcaatgcggt ggggctcgcc ggcaacctca acttcgccct ggtgtggctc       660
     gccttccacc agctcgggtt cctgtggcgg gacgaccggc tcacccctcg cgtcggatgg       720
     ttgatggtcg tggccggcta cgccgggatg ctggtcgccg tgaccgtcgg cccctacccg       780
     acgtcgatgg tgggcctccc gggcgagccg gtctccaaca tggccccgcc gaccgtggcc       840
     ctgctcgccc aggggatcgg catctgcggc ctcgccgtgg tggcccggcc tgtgatgaac       900
     cgggtcctcc ggcgcccccg tgcgtggctg gtcgtggtcc gggccgcgcc gttcgcgatg       960
     accgccttcc tgtggcacct cacggcgctc atggtcgtcc tcgtcacctt gtgggcgctg      1020
     ggggtcgagc agccggcggt ggcgtcgtgg aggtggtggt tgacgaggcc gctgctcttc      1080
     gcggtgctcc tcgtcgtcac ggctgtcgtc gtggcggtgt tcgtccgttt cgaccggggg      1140
     ccccgtaccg cgtcggacgt cccgacgacg gcagctcgtc gctccgatgt cgcggcggcg      1200
     ctgtcggcgg tcctggtctt cttcgggatc ctgatggtct cgatcgtcgg ggtcgacgtt      1260
     ctcggcagcc gacccgtctt cttcctcctg ggggaggtca ctccggtcgt gggcctcggg      1320
     gtgctcgctg ccggtttggc cgtgctgcca ggagccagcc gcgcctggtg gcaccgcgcc      1380
     gctggctga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page