(data stored in ACNUC7421 zone)

EMBL: CP002343.PE264

CP002343.PE264       Location/Qualifiers
FT   CDS_pept        complement(294226..296088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0270"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="COGs: COG1960 Acyl-CoA dehydrogenase; InterPro
FT                   IPR006091: IPR006090; KEGG: kse:Ksed_26500 acyl-CoA
FT                   dehydrogenase; PFAM: acyl-CoA dehydrogenase
FT                   domain-containing protein; SPTR: Putative acyl-CoA
FT                   dehydrogenase; PFAM: Acyl-CoA dehydrogenase N terminal;
FT                   Acyl-CoA dehydrogenase, C-terminal domain; Acyl-CoA
FT                   dehydrogenase, middle domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46826"
FT                   /db_xref="GOA:E6S6U0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U0"
FT                   /protein_id="ADU46826.1"
FT                   /translation="MGHYKSNVRDLEFNLFEVLGRGEILGQGLYSDVDVDAAKDILREV
FT                   ARLSENELAESLLDSDRNPPVYDPATHSVTMPESFHKSFKAYVDGDWGNLDVPAELGGM
FT                   VIPPSLRWATAEMVCGANPAVHMYTASYSFANLLYHLGTDDQKKLAKHIVDKAWHTTMV
FT                   LTEPDAGSDVGAGRTKAIQQPDGTWHIEGVKRFITSAESDLVDNIVHFVLARPEGAGPG
FT                   TKGLSLFIVPKFHVDLETGELGERNGAYVTNVEHKMGLKVSTTCEVTFGDKEPAVGTLL
FT                   GDVHDGIAQMFHVIENARMFVGTKAIATLSTGYLNALEYAKQRVQGADLTQMTDKTAPR
FT                   VTITHHPDVRRSLMLQKSYAEGLRALVLYTATQLDTVAQAQNGNRTVAVEKGSDAELAS
FT                   RVSDLLLPIVKGLGSERAWVLLGTESLQTLGGSGFLQDYPIEQYVRDAKIDTLYEGTTA
FT                   IQGLDFFFRKIVRDKGQALQHVAGQIQEFAKDLGGSLDTERELLGKALEDVQAIVGHMI
FT                   NDLMKSDPRVGGEITNLYKVGQNTSRLLLSAGDLIVGWLLLRQAAIAQAALDAGATGRD
FT                   ADFYRGKVAAASFYAKNVLPKLAAERAIAESIDNDLMDVPESAF"
     atgggccact acaagagcaa cgtacgcgac ctcgagttca acctcttcga ggtgctcggc        60
     cgaggcgaga tcctcggaca gggcctctac agcgacgtcg acgtggacgc cgccaaggac       120
     atcctgcgcg aggtggcccg cctctccgag aacgagctcg ccgagagcct gctcgactcc       180
     gaccgcaacc cgcccgtcta tgacccggcc acccactcgg tgacgatgcc cgagtccttc       240
     cacaagtcgt tcaaggccta cgtcgacggc gactggggca acctcgacgt cccggccgag       300
     ctcggcggca tggtcatccc accgtcactg cgctgggcga ccgccgagat ggtctgcggc       360
     gccaaccccg ccgtgcacat gtacaccgcg agctactcgt tcgcgaacct gctctaccac       420
     ctgggcaccg acgaccagaa gaagctggcc aagcacatcg tcgacaaggc ctggcacacg       480
     accatggtcc tcaccgagcc ggacgccggc tcggacgtcg gcgccggacg gaccaaggcg       540
     atccagcagc ccgacggcac gtggcacatc gagggcgtga agcgcttcat cacgtcggcg       600
     gagtccgacc tcgtcgacaa catcgtccac ttcgtcctcg cccggccgga gggtgccggc       660
     cccgggacca aggggctctc gctcttcatc gtgccgaagt tccacgtcga cctcgagacg       720
     ggtgagctgg gtgagcgcaa cggcgcctat gtcacgaacg tcgagcacaa gatggggctc       780
     aaggtcagca ccacgtgcga ggtgaccttc ggagacaagg agccagccgt cggcacgctc       840
     ctcggcgacg tccatgacgg catcgcccag atgttccacg tcatcgagaa cgcgcgcatg       900
     ttcgtcggga ccaaggccat cgccaccctc tccaccggct acctcaacgc gctcgagtac       960
     gccaagcagc gcgtccaggg cgcggacctg acgcagatga ccgacaagac cgctccgcgc      1020
     gtcacgatca cccaccaccc cgacgtccgc cgctcgctca tgctccagaa gtcctacgcc      1080
     gaggggctgc gcgcgctcgt cctgtacacg gcgacccagc tcgacacggt cgcccaggcc      1140
     cagaacggaa accgtaccgt cgcggtcgag aagggctccg acgccgagct cgccagccgg      1200
     gtgagcgatc tgctcctgcc gatcgtcaag ggcctggggt cggaacgggc ctgggtcctg      1260
     ctcggcaccg agtcgctgca gaccctcggc ggctccggct tcctgcagga ctacccgatc      1320
     gagcagtacg tccgggacgc caagatcgac accctctacg agggcacgac ggcgatccag      1380
     gggctcgact tcttcttccg caagatcgtc cgggacaagg gccaggccct ccagcacgtc      1440
     gccggtcaga tccaggagtt cgccaaggac ctcggtggct cgctcgacac cgagcgcgag      1500
     ctcctcggca aggccctcga ggacgtccag gccatcgtcg gtcacatgat caacgacctg      1560
     atgaagagcg acccgcgcgt cggcggcgag atcaccaacc tctacaaggt gggccagaac      1620
     acgtcgcgac tgctcctcag cgccggtgac ctcatcgtcg gctggctcct cctccgccag      1680
     gccgccatcg cccaggccgc ccttgacgcg ggcgccacgg gcagggacgc cgacttctac      1740
     cggggaaagg tggccgccgc gtccttctat gcgaagaacg tcctgccgaa gctcgccgcg      1800
     gagcgggcca tcgccgagag catcgacaac gacctgatgg acgtgcccga gtcggccttc      1860
     tga                                                                    1863
//

If you have problems or comments...

PBIL Back to PBIL home page