(data stored in ACNUC7421 zone)

EMBL: CP002343.PE266

CP002343.PE266       Location/Qualifiers
FT   CDS_pept        complement(296878..297513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0272"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="COGs: COG2085 dinucleotide-binding protein; InterPro
FT                   IPR004455; KEGG: rxy:Rxyl_1793 reduced coenzyme F420:NADP
FT                   oxidoreductase; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; SPTR: Putative reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46828"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U2"
FT                   /protein_id="ADU46828.1"
FT                   /translation="MHVAIIGSGNVGGALAGAAIAAGHSVTLSAADAAHAAEVAGRTGA
FT                   TAAATNAEAVRDADVVVLAIPGLAVPAVADELRDALQGKVVIDATNPLNESFTDTFTTD
FT                   RSAAEELQERVPGVPVIKAFNTIFASRHGNPSEGGQPLDAYIAGDDAAAKAKAAELAGS
FT                   LGYRVIDAGSLRMARALEEMAFLNISLNAGNGWTWQSGWKLVGPTEAQ"
     atgcacgtgg caatcatcgg ttccggcaac gtcggcggcg cgctcgcagg cgccgcaatc        60
     gcagccggtc actcggtcac cctgtccgcg gccgacgccg cccacgccgc cgaggtcgcc       120
     ggccggaccg gcgcgaccgc agctgcgacc aacgcagagg ccgtgcgcga cgcggacgtc       180
     gtcgtcctcg ccatccccgg cctcgcggtc ccggccgtcg ccgacgagct gcgcgacgcc       240
     ctgcagggca aggtcgtcat cgacgcgacg aacccgctca acgagagctt caccgacacg       300
     ttcaccaccg accggtccgc tgcggaggag ctgcaggagc gcgtccccgg cgtccccgtc       360
     atcaaggcct tcaacacgat cttcgcgagc cgtcacggca acccgagcga gggtggccag       420
     ccgctggacg cctacatcgc cggcgacgac gccgccgcca aggccaaggc cgcagagctg       480
     gccggttcgc tcggctaccg cgtcatcgac gccggcagcc tccggatggc gcgcgccctc       540
     gaggagatgg ccttcctcaa catctcgctc aacgccggca acggctggac ctggcagagc       600
     ggctggaagc tcgtcggccc gacggaagcc cagtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page