(data stored in ACNUC7421 zone)

EMBL: CP002343.PE267

CP002343.PE267       Location/Qualifiers
FT   CDS_pept        297602..298054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0273"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835; KEGG: scb:SCAB_86641 putative MarR family
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; SPTR: Transcriptional regulator; PFAM: MarR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46829"
FT                   /db_xref="GOA:E6S6U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U3"
FT                   /protein_id="ADU46829.1"
FT                   /translation="MTTTTTDHDLVSTFGLLMEAYNSLEKQLGDSLEREAGVPHTWFEV
FT                   MLRISRADAGLAPMGCLAEQVALTGGGVTRMVDRMVAAGLIERVPCAQDRRVVYAALTT
FT                   QGQQVLTKAVAVHEGNLQRILSDFAPGELDTLDETLRRLRTARLPD"
     atgaccacca cgaccaccga ccacgacctg gtctccactt tcggcctgct catggaggcg        60
     tacaactcct tggagaagca gctcggcgac tccttggagc gcgaggccgg cgtgccgcac       120
     acctggttcg aggtcatgct gcgcatctcc cgggctgacg ccggcctggc ccccatgggg       180
     tgtctggccg agcaggtcgc cctcactggg ggcggcgtca cccggatggt cgaccggatg       240
     gtggcggccg gcctgatcga acgggtcccc tgcgcgcagg accgccgggt cgtctatgca       300
     gccctcacca cgcagggcca gcaggtcctc acgaaggcgg tcgcggtgca cgagggcaac       360
     ctgcagcgca tcctgtccga cttcgccccg ggcgagctcg acacgctcga cgagacgctt       420
     cgacgcctcc gcaccgcgcg cctgcccgac tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page