(data stored in ACNUC7421 zone)

EMBL: CP002343.PE268

CP002343.PE268       Location/Qualifiers
FT   CDS_pept        complement(298230..299129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_0348 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46830"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U4"
FT                   /protein_id="ADU46830.1"
FT                   /translation="MTHPTWRGVTICPCLKEPLDELARASGKDILVSPIKGFGSYQVGR
FT                   TASAGTGSGGGHVDLALRGLTPEQKLRLEGLARRIGFYADIREPTWWSPTRRQWLSEKW
FT                   SSHLHMLLKDCRHLSPEARTQLRDWYSGGNGLVGSDPDDGDRTHLRQTWKQYRSDRQGV
FT                   RPPAPQATIAVANLKHGRRNGDVKRYQAAVWRRLAAATRARILAANHLKETQIADGFFG
FT                   DVTVEMTTALYRQIAAREPQGGWPIWAEPGPRLLKRLGFIPAGARDLDDPHDEFGEPDS
FT                   VSDPVSANIDPHPAGVVQ"
     atgacccatc cgacgtggcg tggcgtgacg atctgcccct gcctgaagga gccgctcgac        60
     gagctcgcgc gggcatccgg gaaggacatc ctcgtctcgc ccatcaaggg gttcggctcg       120
     taccaggtcg gccggactgc gtcggcgggg acgggctccg ggggtggaca cgtcgatctc       180
     gccctgcggg gcctcactcc cgagcagaag ctccggctcg agggcctggc gcggcggatc       240
     ggcttctacg ccgacatccg ggagccgaca tggtggtcgc cgacccggag gcagtggctc       300
     agtgagaagt ggtcctccca cctgcacatg ctgctcaagg actgccgtca tctctccccg       360
     gaggcgcgga cccagctgcg cgactggtac tccggtggga acggcctcgt cggcagcgac       420
     cccgacgacg gggaccggac ccatctgcgc cagacgtgga agcagtaccg cagcgaccgg       480
     cagggcgtgc gaccacccgc accgcaggcg accatcgccg tcgccaacct caagcacgga       540
     cgcaggaacg gcgacgtcaa gcgctaccag gctgcggtgt ggcgccggct cgcggcagcc       600
     actcgcgcga ggatccttgc cgcgaaccac ctgaaggaga cccagatcgc ggatggtttc       660
     ttcggcgacg tcacggtcga gatgacgacc gcgctgtacc gccagatcgc ggcgagggag       720
     cctcagggcg gctggccgat ctgggccgag cccggccccc gcctgctcaa acgactgggt       780
     ttcatcccgg ccggcgcccg cgacctggac gacccacacg acgagttcgg cgagcccgat       840
     tcggtctccg atcccgtgtc cgctaacatc gacccgcacc ccgcgggtgt agttcagtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page