(data stored in SCRATCH zone)

EMBL: CP002343.PE269

CP002343.PE269       Location/Qualifiers
FT   CDS_pept        complement(299259..301448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0275"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="COGs: COG2247 Putative cell wall-binding domain;
FT                   InterPro IPR002502: IPR007253: IPR006619; KEGG:
FT                   mcu:HMPREF0573_11044 putative N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   cell wall binding repeat 2-containing protein; SMART:
FT                   Animal peptidoglycan recognition protein PGRP;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SPTR: LytC;
FT                   PFAM: N-acetylmuramoyl-L-alanine amidase; Putative cell
FT                   wall binding repeat 2"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46831"
FT                   /db_xref="GOA:E6S6U5"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U5"
FT                   /protein_id="ADU46831.1"
FT                   /translation="MTPSTRRNLGPTTLAAAALLLPFVLSAAASASAQVQPSETGSPAR
FT                   ASSTVTASASTRPPTTRQTNHALLGADQVPGVTALAAADSAEAAEHAGGKSVKVVSAST
FT                   PVTLPDLGVVGVTWRAGSAPGASIQYRTLDGSTWSDWAFLELDGDHAPDDAEAKEAAAK
FT                   LGGARDGSAPLVTTDSEQVQVRVLAADGSTPDDAQLAVIDPGTSGTSPQPTAPTTSDST
FT                   PGTSTTPGTMTGVAEPVIRTRADWGADETLRDPSEPDYGSVDLAVVHHTAGSNSYSEAD
FT                   VPGIIRGIYAYHVKTRGWRDIGYNFLVDRFGRIWEGRYGGVDRAVVGAHAYGVNSWSMG
FT                   ASVLGDFETTAPPDADKQAIGTALRDLIAWKADVHRFDVLGTTTIGGVTYDNISGHRNV
FT                   NQTECPGQYLYATLPSLRTATAALSPSAPRYAGINRYATAAAASAATFAPGAPVAYIAT
FT                   GASFPDALAGGPAGGYRGGPVLLTTRSSLPVDTETELQRLKPAEIVILGGTAAVSDAVR
FT                   SELAVWAPTVTRVSGADRYSTAAAVSARTFGTGVPVAYIATGANFPDALAGGPAGGFRG
FT                   GPLLLTTSATVPAPTLTELGRLNPASIVVLGGTSAISPEVESVLHDYAPSVVRVAGDDR
FT                   FATAAETSRRTFSPGVPVVFVATGTNFPDALSGGPMGGDLGGPVLITRPDTLPATTADE
FT                   LTRLAPGKVVVLGGTAAVSDAVSKRLYNYEVPPSP"
     atgaccccct ccaccagacg aaacctggga ccgacgaccc tggcggccgc cgcgctcctc        60
     ctgcccttcg tgctctccgc ggcagcctcg gcgtctgccc aggtccagcc gagcgagacc       120
     ggatccccgg cccgcgcctc gtcaacggtc accgcgtcgg ccagtacccg cccgccgacc       180
     acgcgccaga cgaaccacgc gctcctcggg gccgaccagg tgccgggcgt cacggccctc       240
     gccgccgctg actccgccga ggccgccgag cacgccggcg gcaaatccgt caaggtcgtc       300
     tccgcctcga cgcccgtcac ccttcccgac ctcggcgtcg tcggtgtgac ctggcgcgcc       360
     ggctccgccc ccggtgccag catccagtac cgcaccctcg acgggtcgac gtggtcggac       420
     tgggcgttcc tcgagctcga tggcgaccac gcccctgacg acgcggaagc gaaggaggca       480
     gccgcaaagc tcggcggggc gcgcgacggc tccgcaccgc tcgtgacgac ggactccgag       540
     caggtccagg tccgagtcct cgccgcggac gggtcgacgc ccgacgacgc gcagctcgca       600
     gtgatcgatc cggggacctc tgggacctcc ccccagccca cggccccgac gacctcggac       660
     agcacacccg gcacctcgac cacgccgggg acgatgaccg gcgtggccga gccggtgatc       720
     cgcacccgtg ccgactgggg cgccgacgag acgctccgcg acccctccga gccggactac       780
     ggctcggtgg acctcgcggt cgtgcaccac acggccgggt ccaacagcta ctccgaggcg       840
     gacgtgccgg gcatcatccg gggcatctac gcgtaccacg tgaagacgag gggctggcgc       900
     gacatcggct acaacttcct cgtcgaccgg ttcggccgga tctgggaggg tcgctacggt       960
     ggcgtggacc gggccgtcgt cggcgcgcac gcctacggcg tcaactcctg gtcgatgggc      1020
     gcctccgtcc tgggcgattt cgagacgacc gcaccaccgg atgctgacaa acaggccatc      1080
     ggtacggcgt tgcgcgacct catcgcgtgg aaggcggacg tgcaccgctt cgacgtcctc      1140
     ggcacgacga cgatcggcgg tgtcacgtac gacaacatct cgggccaccg gaacgtcaac      1200
     cagaccgaat gccccgggca gtacctctac gccaccctcc cctcgttgcg gaccgccacc      1260
     gccgccctgt caccgagcgc cccccgatac gccggcatca accgctacgc caccgcagcc      1320
     gcggcctcgg cggcgacctt cgcgccggga gcccccgtcg cgtacatcgc caccggcgcc      1380
     agcttccccg acgcgctcgc cggcggcccg gcgggcgggt accggggcgg gccggtcctg      1440
     ctcacgacca ggagctcgct cccggtggac accgagaccg aactgcagcg gctcaagccc      1500
     gccgagatcg tcatcctcgg cggaacggcg gccgtctcgg acgcggtcag gtctgagctc      1560
     gccgtgtggg ccccgaccgt gacgcgcgtg tcgggagccg accggtactc gacggcggcg      1620
     gccgtgtccg ctcgaacctt cggcaccggc gtcccggtcg cctacatcgc caccggcgca      1680
     aacttccccg acgctctggc cggcgggccc gcgggcggtt tccgaggggg gccgctcctg      1740
     ctcacgacca gtgccaccgt gccagcgccg acgctcaccg agctcggccg cctcaacccg      1800
     gcgagcatcg tcgtgctggg cgggaccagc gcgatctcgc ctgaggtcga gtccgtcctc      1860
     cacgactacg cgccctccgt ggtccgggtc gccggcgacg accgcttcgc caccgcggcc      1920
     gagacgtcac gacggacgtt ctctccgggc gtgcccgtgg tcttcgtcgc cacggggacc      1980
     aacttcccgg acgcgctctc cggcggaccc atgggaggcg acctgggcgg ccccgtcctc      2040
     atcacccgcc cggacaccct gccggcgacg accgccgacg agctgactcg cctcgcgccc      2100
     ggcaaggtcg tcgtgctcgg tggcacggct gcggtctctg acgcagtgtc caagcggctc      2160
     tacaactacg aggtgccgcc cagcccctga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page