(data stored in ACNUC7421 zone)

EMBL: CP002343.PE27

CP002343.PE27        Location/Qualifiers
FT   CDS_pept        complement(27275..28366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0027"
FT                   /product="NLP/P60 protein"
FT                   /note="COGs: COG0791 Cell wall-associated hydrolase
FT                   (invasion-associated protein); InterPro IPR000064; KEGG:
FT                   sco:SCO3511 lipoprotein; PFAM: NLP/P60 protein; SPTR:
FT                   NLP/P60 protein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46589"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI8"
FT                   /protein_id="ADU46589.1"
FT                   /translation="MPAPVALAATLAKKLLWRRIRRVAYIALPLVGSGLLGASNEQSGM
FT                   PSKGGACPGAELSDKDVPGLTGEQTRNARTIVAVGRDLNVPSYGWVIAVATAMQESSLV
FT                   NIPHGDRDSVGLFQQRAAWGSTADRMDPVQSARMFYTGGRGGEPGLLDIAGFESVRLTE
FT                   AAQAVQRSAFPSAYAKWEALAVQVVGEPSVIASACYSAASAMDGSAGGEAVRAALRWLG
FT                   TPYSWGGGTINGPGEGFGRGAGIVGFDCSSLTQYAWHQAGASIPRVASAQAAALPSVGL
FT                   DPAGWRAGDLVFFHAPGDPATFFHHVGMYDGQGGMIHAPRTGLTVEVVHDFLSQPYWRN
FT                   ELAYVGRPAVSQELPVVAGARHG"
     atgcctgctc cggtcgcact ggctgccact ctggccaaga agctcctgtg gcgacgcatc        60
     cgccgcgtcg cctacatcgc cctccccctg gtcggatccg ggctgctcgg cgcctcgaac       120
     gagcaatccg gcatgccttc caagggtggc gcgtgtccgg gcgcggagct gagtgacaaa       180
     gacgttccgg gcctgacagg ggaacagacc cggaacgcgc gcaccatcgt agctgtgggc       240
     cgggacctca acgttccgtc ctacggctgg gtcatcgccg ttgccaccgc catgcaggag       300
     tcgagcctgg tcaacatccc ccacggcgac cgcgacagcg tcggcctctt ccagcagcgg       360
     gctgcttggg gcagcaccgc cgacagaatg gaccccgttc agtcggcccg gatgttctac       420
     accggtggac gaggcggtga gccggggctc ctggacatcg ccggcttcga gtccgtgcgg       480
     ctgaccgagg ctgcgcaggc cgtccagcgc agcgctttcc ccagcgccta cgcgaagtgg       540
     gaggcattgg ccgtccaagt cgtcggggag ccgtccgtca tcgcctccgc ctgctactcc       600
     gcagcgtcgg ccatggacgg gagcgcagga ggcgaagctg tccgggctgc gctgaggtgg       660
     ctcggcacgc cctacagctg gggcggaggc acgatcaacg gcccagggga gggattcggc       720
     cgcggcgccg gcatcgtcgg cttcgactgc tcatccctca cgcagtacgc atggcaccaa       780
     gccggcgcaa gcatccctcg tgtcgccagc gcccaggccg cggctcttcc ctccgttggg       840
     ctcgaccccg ccggttggag ggccggagac ctggtgttct tccacgcgcc tggagatccc       900
     gcgaccttct tccaccacgt cggtatgtac gacgggcagg gcggcatgat tcacgccccg       960
     cgcacgggcc tgaccgtcga ggtcgtccac gacttcctct cacagcccta ctggcgcaat      1020
     gagctggcct acgtcggccg accggctgtc tcccaagaac tacccgtcgt cgcaggagcc      1080
     cgccatggct ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page