(data stored in SCRATCH zone)

EMBL: CP002343.PE270

CP002343.PE270       Location/Qualifiers
FT   CDS_pept        complement(301445..301999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0276"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2257 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46832"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U6"
FT                   /protein_id="ADU46832.1"
FT                   /translation="MQPATKVLSITGKGPFGMFGPDLFGDEKARALDYPVLATSEPGAG
FT                   LEASWAAYDPSEIWTLTNLGSLCADRGAATQAVARGKGWDWVFGGGTARYAAPTVVDPP
FT                   DREPYHAVQPVDTGLDGTFAQVIRRSDIAIADHECPVVADEDWSPQLGRALVFSVPEAV
FT                   LPQPWEGRVPVPEITLFQGSP"
     gtgcagccgg ccaccaaggt gctgtcgatc accggcaagg ggccgttcgg catgttcggc        60
     cccgacctgt tcggggacga gaaggccagg gccctcgact acccggtcct cgccacgtcg       120
     gaaccggggg ctgggctgga agcgagctgg gcggcatacg acccgtctga gatctggact       180
     ctcacgaacc tggggagcct gtgcgccgac cgcggcgctg cgacccaggc cgtggcccga       240
     ggcaaggggt gggactgggt cttcggtggg gggaccgcac ggtacgccgc gccgaccgtc       300
     gtcgacccac ccgaccgcga gccctaccac gctgtgcagc cggtcgacac cggactcgac       360
     ggcactttcg cccaggtgat ccggcggtcc gacatcgcga tcgccgacca cgagtgccca       420
     gtggtcgccg acgaggactg gagtccccag ctcgggcgcg cgctcgtctt cagcgtcccg       480
     gaagccgtgc tgccccaacc gtgggaaggt agagtccctg tgcccgaaat caccctattc       540
     caaggttctc catga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page