(data stored in ACNUC7421 zone)

EMBL: CP002343.PE271

CP002343.PE271       Location/Qualifiers
FT   CDS_pept        302509..302838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0277"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: srm:SRM_00813 conserved hypothetical
FT                   protein containing nucleotidyltransferase domain; PFAM: DNA
FT                   polymerase beta domain protein region; SPTR: Putative
FT                   uncharacterized protein; manually curated; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46833"
FT                   /db_xref="GOA:E6S6U7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U7"
FT                   /protein_id="ADU46833.1"
FT                   /translation="MTETAAPARGPLSGPTGRLVAAHREELREVLRRHGVTNAQIFGSV
FT                   ARGDDRPGSDLDLLVELPRGTSLFDLAGIQVELEEVLGVEVDLGTIGSLKPRIRPRVER
FT                   DLVAL"
     atgaccgaga ctgcagcacc ggctcgtggg ccactcagtg gcccaacagg ccgactcgtc        60
     gcagctcacc gggaggagtt gcgcgaggtg ctgcgccgcc acggtgtgac caacgcccaa       120
     atattcggaa gcgttgcgcg cggggacgat cgccccggca gcgatctcga cctgctcgtc       180
     gagctccccc gcgggacgag cctcttcgac ctggcaggca ttcaggtcga gttggaagag       240
     gttctgggcg ttgaggtcga cctcggaacc atcggaagcc tcaagccgcg catccgtccg       300
     cgcgtggaac gagacttggt tgctctatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page