(data stored in ACNUC7421 zone)

EMBL: CP002343.PE272

CP002343.PE272       Location/Qualifiers
FT   CDS_pept        302828..303175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0278"
FT                   /product="protein of unknown function DUF86"
FT                   /note="COGs: COG2361 conserved hypothetical protein;
FT                   InterPro IPR008201; KEGG: afo:Afer_0034 protein of unknown
FT                   function DUF86; PFAM: protein of unknown function DUF86;
FT                   SPTR: Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46834"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U8"
FT                   /protein_id="ADU46834.1"
FT                   /translation="MLYEPFGLDRLYDIADAIAAIRSHVAQGTLSEAVVFDAVRMRLLE
FT                   IGEAVKGLSEELTAREPAIPWRTIARSRDNLAHHYFATELQIVEDTIKADLAPLDEAVA
FT                   RLIAEVERPRG"
     ttgctctatg agccgttcgg actcgaccgg ctctatgaca tcgccgacgc aattgcggcc        60
     attcggtccc atgttgcaca ggggactctc agcgaggctg tggtgttcga cgcggtgcgg       120
     atgcgactcc tcgaaatcgg cgaggccgtc aagggtctca gcgaagaact cacagcaagg       180
     gagcctgcca ttccgtggcg cacgattgcg cggtcgcgag acaacttggc ccatcactac       240
     ttcgcgaccg aactgcagat cgtcgaggac accatcaagg cggacttggc gccactcgac       300
     gaggccgtcg cccggctgat cgcggaagtc gagcggccga gagggtaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page