(data stored in ACNUC7421 zone)

EMBL: CP002343.PE273

CP002343.PE273       Location/Qualifiers
FT   CDS_pept        303459..303890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecx:EcHS_A2423 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46835"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6U9"
FT                   /protein_id="ADU46835.1"
FT                   /translation="MDLVKQDALITHVRERGGHETQVAVTLEQFFDGNDCEWCIAPNRS
FT                   EDLTLGDVRRALVELRGHPDVHDVLVELDQLEFGTYPDDEWPYASGAAVITTLMPDEVD
FT                   ALLLEVEVDPSGGPASSLDWLVDAPAIPAGHHYVGVWWS"
     atggatctcg tcaagcagga cgccctgatc acgcatgtcc gggagcgggg cggccacgag        60
     acccaggtgg ccgtcaccct cgagcagttc ttcgacggca acgactgtga gtggtgcatc       120
     gccccgaacc ggtccgagga cctcaccctc ggcgacgtcc gccgcgccct cgtcgagctg       180
     cgcgggcacc cggacgtcca cgacgtgctc gtcgagctgg accagctcga gttcgggacc       240
     tacccggacg acgagtggcc gtacgcgagc ggagccgccg tcatcacgac cctcatgccg       300
     gacgaggtcg acgcgttgct cctggaggtg gaggtcgacc cgagcggggg gccggcctcc       360
     agcctcgact ggctcgtcga cgcgccggcc atcccggcgg ggcaccacta cgtcggcgtg       420
     tggtggagct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page