(data stored in SCRATCH zone)

EMBL: CP002343.PE275

CP002343.PE275       Location/Qualifiers
FT   CDS_pept        305532..306233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0282"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="InterPro IPR000073; KEGG: sco:SCO0635 hypothetical
FT                   protein; PFAM: alpha/beta hydrolase fold; SPTR: Putative
FT                   uncharacterized protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46837"
FT                   /db_xref="GOA:E6S6V1"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V1"
FT                   /protein_id="ADU46837.1"
FT                   /translation="MPLASLAWDARPARAGAVALVLHGGAVDGREPNHPWSHNVARLVP
FT                   FARALRKVPGPLAVARLRFRYRGWNGAEASPVEDARWALAQIRADYPDAPVALVGHSMG
FT                   GRTALTVADEDNVRLVVGLSPWIERGDPVPRDGRKTVLIHGDRDIITPLSASRRIVEGL
FT                   LDDGRDATLIRVARGDHAMLVRAGLWSTLVVDIVGSTFARELGGWSEPRSGPIGAVVAR
FT                   AVHGSGGILDI"
     atgccgctcg cctccttggc gtgggacgcg cggcccgcgc gggccggggc ggtcgcgctc        60
     gtcctgcacg ggggagcggt cgacgggcgc gagcccaacc acccgtggtc gcacaacgtg       120
     gcccggctcg tgccgttcgc ccgggccctg cggaaggtcc ccggtccgct cgccgtggcc       180
     cgactgcggt tccgataccg cggctggaac ggcgccgagg cgtcaccggt ggaggacgcc       240
     cggtgggcgc tggcgcagat ccgcgccgac taccccgacg cgccggtcgc cctggtcggc       300
     cactccatgg gagggcgtac ggccctgacc gtcgccgacg aggacaacgt gcgactcgtc       360
     gtcggcctct cgccctggat cgagcgcggt gacccggttc cgcgcgacgg acggaagacc       420
     gtcctcatcc acggtgaccg agacatcatc acgccgctgt ccgcgtcgcg ccggatcgtc       480
     gaggggctgc tcgacgacgg gcgtgacgcg accctgatcc gcgtcgcgcg cggcgaccac       540
     gcgatgctcg tgcgggcggg cctgtggagc accctcgtcg tggacatcgt cggatcgacg       600
     ttcgcccgag agctcggggg ctggtccgag ccgcggtccg ggccgatcgg cgcggtcgtc       660
     gcgcgcgcgg tgcacggcag cggtggcatc ctcgacatct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page