(data stored in SCRATCH zone)

EMBL: CP002343.PE277

CP002343.PE277       Location/Qualifiers
FT   CDS_pept        307508..308155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0284"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: nml:Namu_1405 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC-type glycine betaine transport,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46839"
FT                   /db_xref="GOA:E6S6V3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V3"
FT                   /protein_id="ADU46839.1"
FT                   /translation="MSWALDHLGEILSRAGQHAWLAGIPLVLGLLIALPLGWLAARKAW
FT                   LKGPLLSGTGLLYTIPSLALFILLPSILKRGILDPVNVIVAMTIYTVALLTRTVADALS
FT                   SVDPSTRAAATAMGYGGFARFRAVDLPLAVPVLAAGLRVAAVSNVSIVSVASLIGVNQL
FT                   GYFLTNGYARSFATEVWVGIIACVALAVVFDVAIHGIARLLTPWARAAEARS"
     gtgagctggg ccctcgacca cctcggcgag atcctctcgc gcgcaggtca acacgcctgg        60
     ctcgccggga tccccttggt gctcgggctg ctcatcgcgc tgccgctcgg ctggctcgcc       120
     gcgcgcaagg cgtggctcaa ggggccgctg ctgagcggca ccggcctgct ctacacgatc       180
     ccgtcgctgg cgctgttcat cctcctgccg agcatcctca aacgcggcat cctcgacccg       240
     gtcaacgtca tcgtcgccat gacgatctac accgtggcgt tgctgacgcg aacggtggcg       300
     gacgcgctgt cgagcgtcga cccgtccacc cgggcggccg ccacggcgat gggctacggc       360
     ggcttcgccc gcttccgtgc cgtcgacctg cccctcgccg tcccggtgct cgcggccggc       420
     ctgcgcgtcg ccgccgtgag caacgtcagc atcgtcagcg tggcctcgct catcggcgtc       480
     aaccagctcg gctacttcct caccaacggc tatgcgcgca gcttcgccac cgaggtgtgg       540
     gtcggcatca tcgcgtgcgt cgcgctcgcc gtcgtcttcg acgtggccat ccacgggatc       600
     gcccgcctgc tcacgccctg ggctcgagcg gcggaggcga ggtcatga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page