(data stored in ACNUC7421 zone)

EMBL: CP002343.PE278

CP002343.PE278       Location/Qualifiers
FT   CDS_pept        308152..308937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1174 ABC-type proline/glycine betaine
FT                   transport systems permease component; InterPro IPR000515;
FT                   KEGG: kse:Ksed_26240 ABC-type proline/glycine betaine
FT                   transport system, permease component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: ABC transporter-associated permease; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46840"
FT                   /db_xref="GOA:E6S6V4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V4"
FT                   /protein_id="ADU46840.1"
FT                   /translation="MIDDLVTWLQDPAHWSGPDGVPARLSEHVVYTAVTVLVAVVLAVP
FT                   LGAWVGHTGRGRWLVTGANALRAVPSLGLLFAISMLVGPLIQSSLAFTLPSIIVLVILA
FT                   IPPLLSGSYAGVESVDPAARDAARGMGMRGPQVLAQVELPIAMPLLLSGLRSATLQVIA
FT                   TATIAASISLGGLGRYLIDGLAARDLSQMVAGSVLVALLALFTDGALALVQRFLVSPGI
FT                   SGRRTRVGPTDVARIGSPRAGVSSTPRGTSPAVSPNGSD"
     atgatcgacg acctggtcac ctggctgcag gacccggccc actggagcgg gcccgacggc        60
     gtgccggcgc ggctcagtga gcacgtggtg tacacggcgg tcacggtcct cgtcgccgtg       120
     gtgctcgccg tgccgctcgg ggcgtgggtc gggcacaccg ggcgcgggcg ctggctcgtg       180
     accggcgcca acgcgctgcg cgccgtcccg agcctcgggc tcctcttcgc catctcgatg       240
     ctcgtcgggc cgctcatcca gagcagcctc gccttcaccc tgccgagcat catcgtcctc       300
     gtcatcctcg ccatcccgcc gctgttgtcc ggcagctacg ccggtgtcga gagcgtcgac       360
     cccgccgccc gggacgcagc gcgcggcatg ggcatgcgtg gtccccaggt cctggcccag       420
     gtcgagctgc ccatcgccat gccgctcctc ctctccgggc tgcggtccgc caccctgcag       480
     gtcatcgcca cggcgacgat cgcggcgtcg atcagcctcg gcgggctggg tcgctacctc       540
     atcgacgggc tggccgcccg ggacctgtcc cagatggtgg cggggtccgt cctcgtggcc       600
     ctgctcgcgc tgttcaccga cggggcgctt gctctcgtcc aacgtttcct cgtctcgccg       660
     ggaatctccg gcagacgcac ccgtgttgga cctaccgacg tcgcccggat cggctccccc       720
     cgagccggcg tcagctccac cccacgtggc accagccccg cggtctcccc caacggaagt       780
     gactga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page