(data stored in ACNUC7421 zone)

EMBL: CP002343.PE279

CP002343.PE279       Location/Qualifiers
FT   CDS_pept        308940..309863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0286"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG1732 Periplasmic glycine
FT                   betaine/choline-binding (lipo)protein of an ABC-type
FT                   transport system (osmoprotectant binding protein); InterPro
FT                   IPR007210; KEGG: nml:Namu_1403 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: ABC-type glycine betaine transport,
FT                   substrate-binding protein; PFAM: Substrate binding domain
FT                   of ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46841"
FT                   /db_xref="GOA:E6S6V5"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V5"
FT                   /protein_id="ADU46841.1"
FT                   /translation="MPRTRTLLAGLLAAAVLPLAACGSAEDPLAPSQPAGTNAGTGGAS
FT                   SVTIGSADFPESALLGEIYAQALEAKGVTVQRQFNIGNRETYLKAIEGGEVDILPEYTG
FT                   SLTNYFDKTVTATNPDEVYDALKSKLPGGLTVLAKSTAEDKNSMVVTKETADAWSLKAI
FT                   PDLVAHQDELSIAAPPEFRTRQQGLVGLKEVYNLEPKEFRPLASQATVEALKNGQVKAA
FT                   NIFSTDPSIAANGFVVLEDPELLFGSDNVVPLVRDDVAGSVQAPLDAVSAKLDTTALAD
FT                   MVKQVVVDKKDASVVAKEWLTGAGLI"
     atgcctcgca cgcgcaccct gctcgccgga ctcctcgccg ccgcggtcct tccgctcgcc        60
     gcctgtggca gcgccgagga tcctctcgcc cccagccagc cggccggcac gaacgccggc       120
     acgggcggcg cctcgtcggt gacgatcggt tcagccgact tccccgagtc cgcgctcctc       180
     ggcgagatct acgcgcaggc gctcgaggcc aagggcgtca ccgtgcagcg ccagttcaac       240
     atcggcaacc gcgagaccta cctcaaggcg atcgagggcg gggaggtcga catcctcccg       300
     gagtacaccg gctccctgac gaactacttc gacaagaccg tcaccgcgac caaccccgac       360
     gaggtctacg acgcgctcaa gagcaagctc cccggcggcc tcaccgtcct ggcgaagtcc       420
     acggcagagg acaagaactc catggtcgtg accaaggaga ccgctgatgc gtggtccctc       480
     aaggcgatac ccgacctcgt cgcccaccag gacgagctgt cgatcgccgc gccgcccgag       540
     ttccgcaccc gacagcaggg cctcgtcggt ctcaaggagg tctacaacct cgagccgaag       600
     gagttccgcc cgctcgccag ccaggccacc gtcgaggcgc tcaagaacgg ccaggtcaag       660
     gccgccaaca tcttcagcac cgacccctcc atcgccgcca acgggttcgt cgtcctcgag       720
     gaccccgagc tgctcttcgg ctcggacaac gtcgttccgc tggttcgcga cgacgtcgcc       780
     ggatcggtcc aggcgccgct cgacgccgtg tcggccaagc tcgacacgac agccctcgcc       840
     gacatggtca agcaggtcgt cgtcgacaag aaggacgcga gcgtcgtcgc caaggagtgg       900
     ctcaccgggg cgggcctcat ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page