(data stored in SCRATCH zone)

EMBL: CP002343.PE28

CP002343.PE28        Location/Qualifiers
FT   CDS_pept        complement(28368..28982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1188 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46590"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEI9"
FT                   /protein_id="ADU46590.1"
FT                   /translation="MSDNLNRALRWPLWSWRNLAITVVSLFVAIALIGRVSSALGGDGE
FT                   APIKAASTAVPEGTQSPPAVTPSTGPLVSPAQTPTADLAAGPGTDCLSNAAQFVDEWMQ
FT                   TKRSQQLWLARMAPYATPAFLEELRSVDPANVPATTVEGEPQLVGQDGDLPIARITTDG
FT                   GRLDLVLARSGSTCVVSDIRSSDDVPGAPTPVLTATPKAGG"
     atgagtgaca accttaaccg tgcgctccgc tggccgctct ggtcatggcg caacctggcc        60
     atcaccgtgg tgtcgctctt cgtcgctatc gccctcatcg gtcgagtcag ctcggccctc       120
     gggggcgacg gcgaagcgcc aatcaaggca gcgtccacgg cggtccccga gggcacgcag       180
     tcgccacccg cggtaacgcc atcgaccggg ccgctcgtgt cgcctgccca aaccccaact       240
     gcagaccttg ccgccggacc cggcacggac tgcctctcga acgcggcaca gttcgtagac       300
     gagtggatgc agacgaagcg ctctcagcag ttgtggctgg cgaggatggc gccctacgcg       360
     actcccgcgt tcctcgagga gctccgcagc gtcgatcccg ctaacgtgcc tgcgaccacg       420
     gtcgagggag agccccagct cgttggccag gacggtgacc tgcccatcgc gcgcataacc       480
     accgatggag gacgcctcga cctcgtcctc gcacgctcgg ggtcgacgtg tgtcgtaagc       540
     gacatccgct cgtcagacga cgtgcccggc gctccgacgc ctgtcctcac cgccactcca       600
     aaggcaggag gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page