(data stored in ACNUC7421 zone)

EMBL: CP002343.PE282

CP002343.PE282       Location/Qualifiers
FT   CDS_pept        312134..313156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_4025 NB-ARC domain-containing
FT                   protein; SPTR: Putative WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46844"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6V8"
FT                   /protein_id="ADU46844.1"
FT                   /translation="MPTISPDAQRVAVQHYGPGQTLELRSAADGAVRWSKTLEDLGDQS
FT                   PEGPLEDMADGVVWLDASTLAVVGATQWLELDADSGAIEKAHPFPDQLPFITEVRDFGG
FT                   GRFGVSVEGDQTLVIDRSRPTDGGQRIDGYLFGHPGTGRAVTVVEHKADNTMALTPLRS
FT                   TRDPRPAGGSVTVDGFAPWVSFTRDGAQLVVCVENRVELRDARTGALRRTFVGHSGSVM
FT                   QARVAGSARPGLDGRAGRRDRFGELPLGECPGDCQVAATAMSPDGATAYGSVEYIVDMG
FT                   PGDRGVVVAWDAATGERRATWPTPWPAYSISVTLSGRTALLNGRWGWGLMDLSSGALVW
FT                   "
     atgcccacca tctcgcccga tgcccagcgc gtggcggtgc agcactacgg cccgggccag        60
     accctcgagc tgcgctcggc cgctgacggt gcggtgcggt ggagcaagac cctcgaggac       120
     ctgggcgacc agagccccga gggacccctg gaggacatgg ccgacggcgt cgtctggctc       180
     gatgcgtcga cgctggccgt cgtgggcgca acccaatggc tcgagctcga cgcggacagc       240
     ggcgcgatcg agaaggctca ccccttcccc gaccagctgc ccttcatcac cgaggtccgc       300
     gacttcgggg gtggccggtt cggggtgtcc gtcgaaggag accagacgct cgtcatcgac       360
     cggagccggc cgactgacgg aggacagcgg atcgacggtt accttttcgg tcatcccggc       420
     acgggccgag cggtcaccgt ggtcgagcac aaggctgaca acaccatggc gctgactccg       480
     ctgcgctcca cccgggaccc acggcccgca ggcgggtccg tgaccgtcga cggcttcgcc       540
     ccctgggtca gcttcacccg ggacggcgcg cagctcgtcg tctgcgtgga gaaccgggtg       600
     gagcttcgag atgcccggac cggagccctt cgacgaacgt tcgtcgggca cagcggctcg       660
     gtgatgcagg cgcgcgtcgc cgggtcggca cgacctggtc tggacggcag ggcgggacgg       720
     cgcgaccgct tcggcgagct tcccctgggt gagtgcccgg gcgactgcca agtggcagcc       780
     acggcgatga gccccgacgg tgcgaccgcc tacggctccg tcgagtacat cgtcgacatg       840
     ggcccgggcg accggggcgt cgtcgtcgcc tgggacgcgg ccacgggtga acgcagggcg       900
     acgtggccga cgccctggcc ggcctacagc atctccgtga ccctctcagg acgcacggcg       960
     ctcctcaacg gccggtgggg ctggggcctc atggacctgt cctcgggcgc gctggtgtgg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page