(data stored in ACNUC7421 zone)

EMBL: CP002343.PE284

CP002343.PE284       Location/Qualifiers
FT   CDS_pept        complement(313880..314068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46846"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W0"
FT                   /protein_id="ADU46846.1"
FT                   /translation="MHEGLDQAGTATHAGYTDEMEPTFRATVYVNISHCGVEVGTTHDP
FT                   FHLTDVQSAVEYTEQHD"
     gtgcacgagg gcctcgacca ggcgggcacg gcgacgcacg ccggctacac ggacgagatg        60
     gagccgacct tccgggccac ggtctacgtc aacatctcgc actgcggcgt cgaggtcggt       120
     acgacccacg acccgttcca cctgaccgac gtccagtcgg cggtggagta caccgagcag       180
     cacgactga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page