(data stored in ACNUC7421 zone)

EMBL: CP002343.PE286

CP002343.PE286       Location/Qualifiers
FT   CDS_pept        complement(315017..316279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0293"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterPro IPR003018: IPR001867;
FT                   KEGG: nca:Noca_2091 transcriptional regulator; PFAM:
FT                   transcriptional regulator domain-containing protein; GAF
FT                   domain protein; SPTR: Transcriptional regulator; manually
FT                   curated"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46848"
FT                   /db_xref="GOA:E6S6W2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W2"
FT                   /protein_id="ADU46848.1"
FT                   /translation="MAMQPYRDRGVRAQVAESWVRSAAAGVQADTVDAPITLAADVLHD
FT                   HREAHPLAAVFPALDDVLGQAARDCDAIMAVSDAAGQLLWVCGTPSVLRRAEAIGFVEG
FT                   SNWDERVAGTNAPGMALRLDAPVRIIGAEHFRRSVQRWSCAATPIHDPSDQSLLGVLDI
FT                   TCADELVVPQTMAMVRAAARMAEAELARELLVRSRPGGSGTERQRPGLGAMLEVLGRDE
FT                   ALLRVDDGHGRQSTLRLSRRHSEILLLLAAAPRGLSGDELAVLLYEDDVSPSTLRVELG
FT                   RLRSLLGDELLASRPYRLVADVSSDWLAVESHLAAGAIGQALRAYRGPLLPRSAAPGVS
FT                   RLRDGLAGSVRRAVLASREADLMSTWTRSSWGADDYEMWQAQLSALGTRSPLRPLVTAQ
FT                   LARLDRELGTGTEPSGIRTAR"
     atggcaatgc agccgtaccg ggaccgcggg gttcgcgccc aggtcgccga gtcctgggtg        60
     cgctccgccg cggccggggt gcaggcggac accgtcgacg caccgatcac cctggcggcc       120
     gatgtcctgc acgaccaccg cgaggcccac ccgctcgcgg ctgtgttccc cgccctcgac       180
     gacgtgctcg gccaggcggc ccgcgactgc gacgcgatca tggcagtgtc cgacgcggcc       240
     ggccagctgc tctgggtctg cgggacgccg agcgtgctcc gacgggccga ggcgatcggc       300
     ttcgtcgagg gttcgaactg ggacgagcgc gtggccggca ccaacgcccc gggaatggcc       360
     ctgcgtctcg acgcgccggt caggatcatc ggggcagagc acttccgtcg ctcggtccag       420
     cgctggagct gcgccgccac gccgatccac gacccgagcg accagtcgct gctgggcgtc       480
     ctcgacatca cctgcgccga cgagctcgtc gtcccccaga cgatggccat ggtgcgagcc       540
     gccgcccgga tggcggaggc agagctggcc cgggagctgc tcgtccggtc ccgccccggt       600
     ggttccggga ccgagcggca gcggcccggg ctgggcgcga tgctcgaggt cctcgggcgg       660
     gacgaggcgc tgctccgcgt cgacgacgga cacggccgcc agagcaccct gcgcctcagc       720
     cggaggcaca gcgagatcct cctgctcctc gcggccgccc cgcgcggcct gtccggggac       780
     gagctcgccg tcctgctcta cgaggacgac gtgagcccgt ccacgcttcg cgtcgagctc       840
     ggccggctca ggtcgctgct cggcgacgag ctcctcgcgt cgcgtccgta ccggctcgtg       900
     gcggacgtct cctccgactg gctcgccgtg gagtctcacc tcgcggcggg agccatcggg       960
     caggccctcc gcgcctaccg cggccccctc ctgccccggt ccgcggcccc cggcgtgtcg      1020
     cgactgcggg acggcctcgc ggggtcggtc cgcagggccg tccttgccag ccgggaggcg      1080
     gacctcatgt ccacctggac acggtcgtcc tggggcgccg acgactacga gatgtggcag      1140
     gcccagctga gcgctctcgg cacccgatcc ccgctccggc ccctcgtgac cgcccagctc      1200
     gcccggctcg accgcgagct cggcacggga actgagccca gcggcatacg gactgcccgc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page