(data stored in ACNUC7421 zone)

EMBL: CP002343.PE288

CP002343.PE288       Location/Qualifiers
FT   CDS_pept        317967..318425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0295"
FT                   /product="protein of unknown function DUF779"
FT                   /note="COGs: COG3564 conserved hypothetical protein;
FT                   InterPro IPR008497; KEGG: sen:SACE_2914 hypothetical
FT                   protein; PFAM: protein of unknown function DUF779; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF779)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46850"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W4"
FT                   /protein_id="ADU46850.1"
FT                   /translation="MDETRLSRVELTREAADLLRRLTARHGPLMFHQSGGCCDGSAPMC
FT                   YPANEFLTSDADVLLAALVVPDVQDAVPFWMSRVQYEYWKHTHLTVDVVPGRGSGFSVE
FT                   APEGVRFLIRSRLLTDAEAEAWGIQPPSLLGPEALFGPPGAAPPGLRH"
     atggacgaga cccggctgag ccgggtcgag ctgacgcgtg aggcggcgga cctgctccgc        60
     cgcctcaccg cgcggcacgg cccgctgatg ttccaccagt ccggtggctg ctgtgacggc       120
     agcgcgccca tgtgctaccc ggcaaacgag ttcctcacca gcgacgcgga cgtgctcctc       180
     gcggcgctgg tcgttcccga cgttcaggac gccgtaccgt tctggatgtc gcgggtgcag       240
     tacgagtact ggaagcacac ccaccttacg gtcgatgtcg ttcccggccg gggcagcggc       300
     ttctcggtcg aggcccccga gggggtccgg ttcctcatcc gctcgcggct cctcacggac       360
     gcagaggccg aggcctgggg catccagccg ccctcgctgc tcgggcccga agccctcttc       420
     ggtccccctg gggcggcacc cccgggacta cgtcactga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page