(data stored in SCRATCH zone)

EMBL: CP002343.PE289

CP002343.PE289       Location/Qualifiers
FT   CDS_pept        complement(318640..319437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0296"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR001107:
FT                   IPR001972; KEGG: pac:PPA1973 stomatin/prohibitin-like
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: SPFH domain / Band
FT                   7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46851"
FT                   /db_xref="GOA:E6S6W5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W5"
FT                   /protein_id="ADU46851.1"
FT                   /translation="MPGFIAPVLAVLVIVAAVIATSLRVIPQYERGVVFRLGKLRPLYQ
FT                   PGLHLLVPGVFRLQRVDLRVVTLTIPPQEVITKDNVPARVNAVVLFNVVDPEAAVMQVE
FT                   NYAVATSQIAQTTLRSVLGRADLDTLLAHRDDLNRDLREIIELQTKPWGVDVSVVEIKD
FT                   VEIPEQMQRAMAREAEAERERRAKVINARGELQASGELKQAADVLSQSPASLQLRYLQT
FT                   LLELGADQNSTVVFPLPMDIVGPLLNRLAPPPANPPANPPASS"
     atgcccggct tcatcgcccc tgtcctcgca gtcctggtca tcgtcgccgc ggtcatcgcg        60
     acgtcgctcc gggtcatccc acagtacgag cgaggcgtcg tcttccggct cggcaagctc       120
     cggccgctct accagcccgg acttcacctg ctcgttcccg gcgtgttccg cctccaacgc       180
     gtcgacctgc gcgtcgtgac cctgacgatc ccgccgcagg aggtcatcac caaggacaac       240
     gtcccggcgc gcgtcaatgc tgtcgtcctg ttcaacgtgg tcgaccccga ggccgccgtg       300
     atgcaggtgg agaactatgc ggtcgccacc tcgcagatcg cccagacgac gctgcgctcg       360
     gtgctcggcc gcgccgacct ggacacgctg ctcgcccacc gcgacgacct caaccgcgac       420
     ctgcgcgaga tcatcgagct gcagaccaag ccgtggggcg tcgatgtttc cgtcgtcgag       480
     atcaaggacg tcgagatccc cgagcagatg cagcgggcca tggctcgtga ggccgaggcc       540
     gaacgcgagc ggcgcgccaa ggtgatcaac gcccggggcg agcttcaggc gtccggtgag       600
     ttgaagcagg ccgctgacgt gctgtcgcag agccccgcgt cgctgcagct gcgctacctg       660
     cagacgctgc tggagctcgg ggccgaccag aactccacag tggtctttcc gttgcccatg       720
     gacatcgtgg ggccgcttct caaccggctc gctccgccgc cggcaaaccc gccggcgaac       780
     ccgcctgcca gcagttag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page