(data stored in ACNUC7421 zone)

EMBL: CP002343.PE29

CP002343.PE29        Location/Qualifiers
FT   CDS_pept        complement(28975..31014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4736 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46591"
FT                   /db_xref="GOA:E6SEJ0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ0"
FT                   /protein_id="ADU46591.1"
FT                   /translation="MAGKRLVRTGPTRLVGRLLIVLFFSIVAGVAVGSEAIATPALPAA
FT                   PWDCKDAPIAAMPDSGLPGFFDPAPDPIPPQGDPFAATRSTTVYDQYGYAGLSWSTYDL
FT                   GCGGAVRDIEATTDTFLGNFFFSGATWMASATNGIHNKVAHPDEYMAPLDVVVGTVTQR
FT                   MHERIWSPWGMVAFLGVAALLLAYSLRGHLSSVMTAAAWALLVVAVLSGISQYPTRTAS
FT                   FFDETVTQSIASINQTSAGLTPSAGADPTRAQGALIVDDVLYQAWLRGQFGDPNSAAAQ
FT                   KWGPVLFRESTFSRTEAATASSTPDGIQKMTEQKANDWVTTTQEIQEQDPIAYAAVQGK
FT                   SKGRAGAGFMAFIGVLFTGLFRLVADLFMFAGLVMLRLLVMFFPAAAVFGVLAPMASIV
FT                   RRIGNIAGASVINVIAFGAGSAIHTVLIAAILFRADGAGMGVLSFVLCLVVTVAAFIML
FT                   MPLLSLTNVLGRPSSTQTLLRRAGRRVRRRHLRRGRHGEGDDDDDEEEDESEEDEDEEE
FT                   APRRRSGRRRRRSARRTRPPVEAFGRPATVPLSAPVSAGDPGVHTTDGRDAGHSLPAAS
FT                   RKSGVPVNAQGSADLRPPTESPAPSGGHGVHRPSTAETPHTRDRVVVGVLVDELPTEIR
FT                   ETPATRIHDSHTEVRPDGVGPRLYDPATKQTVLPEAHSRGVADE"
     atggccggca agaggctcgt ccgcaccggc ccgactcgtc tcgtggggcg gctcctcata        60
     gtcctgttct tcagcatcgt ggcaggcgtg gcggtgggct cggaggccat cgcgaccccc       120
     gccctgccgg cggctccctg ggactgcaag gacgccccga tcgcggccat gccggactcg       180
     ggactcccgg gctttttcga cccggctccc gatcccattc ctccacaggg cgacccgttc       240
     gcagccacac ggtccacgac cgtctacgac cagtacggct acgccggcct gtcctggagc       300
     acctacgacc tcggctgtgg cggtgccgtg cgtgacatcg aggccaccac ggacacgttc       360
     ctggggaact tcttcttctc gggcgccacg tggatggcct cggccaccaa cgggatccac       420
     aacaaggtcg cgcatcccga cgagtacatg gcgcccttgg acgtcgtcgt cgggaccgtc       480
     acccagcgca tgcacgagcg gatctggtca ccgtggggca tggtcgcctt cctcggcgtg       540
     gccgccctgc tcctggccta ctcgctccgc ggccacctct cgtcggtcat gacggccgca       600
     gcctgggcac tgctcgtggt tgcggtcctg tcaggcatct cgcagtaccc cacccgcacc       660
     gcgagcttct ttgacgagac cgtgacccag tccatcgcct ccatcaacca gacgagtgcg       720
     gggctcaccc cgtcggctgg tgccgacccg acccgagcgc agggcgcgct catcgtcgac       780
     gacgtgctct accaggcgtg gctccgcggc cagttcggag acccgaacag cgctgccgcc       840
     cagaagtggg gcccggtcct cttccgggag agcaccttca gccgcaccga agcggcgacc       900
     gcgtcgagca cgcctgacgg catccagaag atgaccgagc agaaggccaa cgactgggtc       960
     accaccacgc aggagatcca agaacaagac cccatcgcgt atgccgcggt gcagggcaag      1020
     tcgaaggggc gtgccggagc cggcttcatg gccttcatcg gcgtcctctt caccggcctg      1080
     ttccgcctcg tcgctgacct cttcatgttc gccggcttgg tcatgctccg gctgctcgtc      1140
     atgttcttcc cggctgcggc cgtcttcggg gtgctggcgc ccatggcgtc gatcgtgcgg      1200
     cgcatcggca acatcgccgg cgcctcggtc attaacgtga tcgccttcgg cgccggctcc      1260
     gccattcaca cggtgctcat cgccgcgatc ctcttccgag ccgacggcgc agggatgggc      1320
     gtgctgagct ttgtgctctg cctggtcgtg actgtggcgg ccttcatcat gctcatgccc      1380
     ttgctgtcgc tcacgaacgt cctcggccgc ccgtcgagca cccagaccct gcttcgtcga      1440
     gctggccgtc gagtcaggcg ccgtcatctg cggcgaggcc gtcatgggga aggcgatgac      1500
     gacgacgacg aagaagagga tgagtcggaa gaggacgagg acgaagaaga ggccccacga      1560
     cgtcgctcag gtcgtcgtcg gcgccgctcg gcccgtcgca cgcgcccacc ggtggaggcc      1620
     ttcggccgtc ccgccacggt cccgctgagc gcaccagtct cagccggaga tcccggcgtc      1680
     cacaccactg atggccgtga cgcggggcat tcgttaccag ccgcgtctag gaagtccggg      1740
     gttccggtca acgcgcaggg atctgccgat ctgcgaccgc ccacggagtc tccggctcct      1800
     tctggtggtc atggagtcca ccgaccgtcc acagccgaga cacctcacac gcgcgacagg      1860
     gtcgtggtgg gcgtgctcgt cgacgagctt ccgacggaga tccgcgagac gcctgccacc      1920
     cggattcacg actcgcacac cgaggtccgc ccagacggcg tgggtcctcg gctgtacgac      1980
     ccggcaacca agcagaccgt cctgccagaa gcacactcac gaggagtagc ggatgagtga      2040
//

If you have problems or comments...

PBIL Back to PBIL home page