(data stored in ACNUC7421 zone)

EMBL: CP002343.PE290

CP002343.PE290       Location/Qualifiers
FT   CDS_pept        complement(319443..320123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP3182 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46852"
FT                   /db_xref="GOA:E6S6W6"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W6"
FT                   /protein_id="ADU46852.1"
FT                   /translation="MRTPSVTVLLVSGYSAVLLVVAWLFDRMGARSAERSARWRTGNFI
FT                   YHEDQDAWKCHQDQWLWPASFDPDKRVIRYEGQHAICGRCPVKTECSPTPGPRELTRQV
FT                   DPWPHSEAGRFHRGIALAVASVAVFMPTAMLLGAHGAGDVIVLVTTVAVGIIAGVPLAQ
FT                   HLWNAPTNFPQHLRSDASSDAPGMPEPTADAAVAPLDHLLDRYQTRWASDRRRVDLPDP
FT                   KTRK"
     atgcgaaccc cgtccgtcac cgtgctgctc gtcagtgggt actctgccgt cctcctcgtc        60
     gtcgcctggc tcttcgaccg catgggggcg cgatccgctg aacggtcggc gcggtggcgg       120
     acggggaact tcatctacca cgaggaccag gacgcctgga agtgccacca ggaccagtgg       180
     ctctggcccg cgtccttcga ccccgacaag cgggtgatcc gctacgaggg ccagcacgcg       240
     atctgcgggc gctgccccgt caagaccgag tgctcgccca cgcccggccc tcgggagctg       300
     acccgccagg tcgacccgtg gccgcactcc gaggcgggcc gcttccaccg cgggatcgct       360
     ctcgccgtgg cgtccgtcgc agtcttcatg ccgaccgcga tgctcctcgg cgcccacggg       420
     gccggcgacg tcatcgtcct cgtgacgacg gtcgcggtcg ggatcatcgc cggtgtgccc       480
     ttggcccagc acctgtggaa cgcacccacc aacttccctc agcacctgcg cagcgacgcc       540
     tccagcgacg cccccggaat gcccgagccg accgctgatg ccgccgtggc cccgctcgac       600
     cacctgctcg accgctacca gacccggtgg gcgagcgacc ggcgtcgcgt cgacctgcct       660
     gaccccaaga cacggaagtg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page