(data stored in ACNUC7421 zone)

EMBL: CP002343.PE291

CP002343.PE291       Location/Qualifiers
FT   CDS_pept        complement(320132..322441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0298"
FT                   /product="nitric oxide reductase, NorZ apoprotein"
FT                   /note="COGs: COG3256 Nitric oxide reductase large subunit;
FT                   InterPro IPR000883; KEGG: mjl:Mjls_1539 nitric-oxide
FT                   reductase subunit B; PFAM: cytochrome c oxidase subunit I;
FT                   SPTR: Nitric oxide reductase; PFAM: Cytochrome C and Quinol
FT                   oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46853"
FT                   /db_xref="GOA:E6S6W7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W7"
FT                   /protein_id="ADU46853.1"
FT                   /translation="MVATPTQRDTSQRQMLVGKGWVQGVALVMLFGFFVMGILAYRTYT
FT                   ASMPQPDKVVSQSGETVFTTEDITAGQVIFQARGLMQYGSIMGHGGYLGPDFTAEYLRH
FT                   ATEFTEHQIRDSGAQDPRTLNVEEWRTNRYDETTGVLTFTDNQVSAFQDAKAYYTGFFG
FT                   ENSTKYGLKPRLITDPQQIHQLTAFFAWTAWASAAERPGFDYSYTNNWPMEPRVENGPT
FT                   PDLLVWSGLSLIALIGGTGLLFAIYGRWSRKIGWHSEEAPAIAFRQPGTVGLTLAQRAT
FT                   AWFFFVIALLFLIQVVVGAAAEHYRADILSFFGFDLAQWLPYNLARTWHVQLSLFWTAA
FT                   GFLAAGIFLTPLISGREPKGQHRIAYALLGALAVVVFGSLTAEALSIHGVEWAKGPLFQ
FT                   QQWEYLDLPRIFQILLTVGMILWITMIFRGIRSRLKGESKGNMPWLFFFSALAIPAFYA
FT                   VGLLASSETHLTVAEFWRFWVVHLWVEDFLELFTTVMVAYIFVMLGVVREKIALGIIFM
FT                   DVILYSMGGVIGTMHHLYFSGTPVEHMALGAFFSAAEVIPLTFLTVEAWAFMQLGARQE
FT                   AKTSAPFPHRWAVMFLVAVGFWNFLGAGVFGFLINLPIVSYYEIGTALTANHGHAAMMG
FT                   VYGMLAVGLAMFALRYLIPPDKWPEKWAKVSFWSLNIGLAWMVFATLLPLGVLQLYHSV
FT                   GQGYYEARELAFITNNTNALLEWGRMPGDLIFIIGGVLPFLWITWLGLRHYRDGTVVDE
FT                   LPQDVLFVELEPVKKK"
     atggttgcta cgccaaccca gagggacacc tcgcaacgac agatgctggt aggaaagggc        60
     tgggtccagg gcgtcgccct cgtcatgctc ttcgggttct tcgtgatggg gatcctcgcc       120
     taccggacct acaccgcctc gatgccccag ccggacaagg tggtgagcca gagcggcgag       180
     accgtcttca ccaccgagga catcaccgcc ggccaggtca tcttccaggc ccgcgggctg       240
     atgcagtacg gctcgatcat gggccacggc gggtacctcg gaccggactt caccgccgag       300
     tacctccgcc acgccaccga gttcaccgag caccagatcc gcgacagcgg cgcccaggac       360
     ccccggaccc tcaacgtcga ggagtggcgc accaaccgct acgacgagac caccggggta       420
     ctcaccttca ccgacaacca ggtgagcgcg ttccaggacg ccaaggccta ctacaccggc       480
     ttcttcggcg agaactccac caagtacggg ctcaaaccgc gtctcatcac cgacccgcag       540
     cagatccacc agctcaccgc gttcttcgcg tggaccgcct gggcctccgc tgccgaacgc       600
     cccgggttcg actactcgta cacgaacaac tggccgatgg agccccgcgt cgagaacggc       660
     cccaccccag acctgctcgt ctggtccggc ctgtccctca tcgccctcat cggcgggacc       720
     gggctgctct tcgccatcta cggtcgctgg agccgcaaga tcggctggca ctccgaggag       780
     gcgcccgcca tcgccttccg gcagccgggc accgtcggcc tcaccctcgc acaacgcgcg       840
     acggcctggt tcttcttcgt catcgcgctg ctcttcctca tccaggtcgt cgtcggggcc       900
     gcggcggagc actaccgggc cgacatcctg tccttcttcg gcttcgacct ggcccagtgg       960
     ctgccctaca acctggcgcg gacctggcac gtccagctgt ccctcttctg gaccgccgca      1020
     gggttcctcg cagccggcat cttcctcacg ccgctcatct ccggccgcga gccgaagggc      1080
     cagcaccgga tcgcctacgc gctcctcggg gccctcgcgg tcgtcgtctt cgggtcgctc      1140
     accgcggagg cgctgtccat ccacggcgtc gaatgggcca agggcccgct gttccagcag      1200
     cagtgggagt acctcgacct gccgcgcatc ttccagatcc tgctcaccgt cggcatgatc      1260
     ctgtggatca ccatgatctt caggggaatc cgctcccgcc tcaagggcga gtccaagggc      1320
     aacatgccct ggctcttctt cttctcggcc ctcgccatcc cggcgttcta cgccgtcggc      1380
     ctgctcgcct cgagcgagac gcacctgacg gtcgctgagt tctggcgctt ctgggtcgtg      1440
     cacctctggg tcgaggactt cctcgagctg ttcacgaccg tcatggtcgc gtacatcttc      1500
     gtcatgctcg gcgtggtccg ggagaagatc gccctcggca tcatcttcat ggacgtcatc      1560
     ctctactcca tgggtggcgt catcgggacg atgcaccacc tgtacttctc cggcacgccg      1620
     gtggagcaca tggcgctggg tgcattcttc tccgccgctg aagtgatccc gctgaccttc      1680
     ctcaccgtcg aggcctgggc gttcatgcag ctcggtgccc ggcaggaggc caagacgtcc      1740
     gctccgttcc cgcaccgctg ggccgtcatg ttcctcgtcg ccgtcggctt ctggaacttc      1800
     ctcggcgccg gtgtgttcgg tttcctcatc aacctgccga tcgtcagcta ctacgagatc      1860
     ggcacggcct tgaccgccaa ccacggccat gccgcgatga tgggcgtcta cggcatgctt      1920
     gccgtcggcc tggcgatgtt cgccctgcgc tacctcatcc cgccggacaa gtggcccgag      1980
     aagtgggcca aggtctcctt ctggagcctc aacatcggct tggcgtggat ggtgttcgcg      2040
     accctgctgc ccctcggcgt gctgcagctc taccactcgg tgggccaggg ctactacgag      2100
     gcgcgggagc tcgcgttcat caccaacaac accaacgcgc tgctcgagtg gggccgcatg      2160
     cccggcgacc tcatcttcat catcggcggc gtgctgccgt tcctctggat cacctggctc      2220
     gggctgcgac actaccgaga tggcacggtc gtcgacgagc tgccgcagga cgtgctcttc      2280
     gtcgagctcg agcccgtcaa gaagaagtag                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page