(data stored in ACNUC7421 zone)

EMBL: CP002343.PE292

CP002343.PE292       Location/Qualifiers
FT   CDS_pept        complement(322651..323331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3173 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46854"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6W8"
FT                   /protein_id="ADU46854.1"
FT                   /translation="MTDHLDSRALRGTDTYGQRFMRPGTYRYALGPAGTGRYTQDHPYV
FT                   ITVGEGEPKRGEMRQTLVVVHREGRTLVPDQPKLSINAGDMVMWHAPGAGTRPFVVVGE
FT                   KEFFTSERLVNESGYTHAFTSEGVYEWADAHGSGARGVVRVTNPDVSTAKGQRAWARSQ
FT                   RQGTVVMVNDGQAEPAEVDVVVGQTVFFAVVAGPGITITDQSLLEHDRPGKGGAFYRKA
FT                   APVR"
     atgacagacc accttgacag cagggcactg cggggaaccg acacctacgg gcagcggttc        60
     atgcggcccg gcacctaccg ctacgcgctg ggccccgccg ggaccgggcg ctacacgcag       120
     gaccacccct acgtcatcac cgtcggtgag ggcgagccga agcgcggcga gatgcgccag       180
     accctcgtcg tcgtgcaccg cgagggccgc acgctcgtgc ccgaccagcc gaagctgagc       240
     atcaacgccg gcgacatggt gatgtggcac gcacccggag cgggcacgcg ccccttcgtc       300
     gtcgtcgggg agaaggagtt cttcaccagc gagcgcctcg tcaacgagtc cggctacacc       360
     cacgccttca cgagcgaggg cgtctacgag tgggccgacg cgcacggctc cggtgcccgg       420
     ggcgttgtcc gcgtcaccaa cccggacgtc tccacggcca aggggcagcg cgcctgggcc       480
     cggtcccagc gccagggcac cgtcgtcatg gtcaacgacg gccaggccga gccggcggag       540
     gtcgatgtcg tcgtcggaca gacggtgttc ttcgccgtcg tcgccggccc cgggatcacc       600
     atcaccgacc agtccctcct cgagcacgac cggcccggaa agggaggagc cttctaccgc       660
     aaggccgccc ccgtccgctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page