(data stored in SCRATCH zone)

EMBL: CP002343.PE294

CP002343.PE294       Location/Qualifiers
FT   CDS_pept        complement(324158..324880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_3175 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46856"
FT                   /db_xref="UniProtKB/TrEMBL:E6S6X0"
FT                   /protein_id="ADU46856.1"
FT                   /translation="MSLTESSEVFVSAHETAINDLVTAICQTRPHLLSYGSPAFVPASD
FT                   VYDTQMPPILFPGSGGIEWHVRFSIPHLDLFDEDSPLPPELSLGPGQFSLSTTVELCVD
FT                   CRKGGRRDDGGKDDGGKDDGHDHPDEPNRDRPWDDKPSKVEHPVCTKLDVFAVGHLVGT
FT                   STAGGPAVGFALDAVEIVDIHPDELESVLECLLAQMLRAALAQVRLPVSALQAGAFSLT
FT                   PTVGPLIDTDVVLARGNL"
     atgagtctca ccgagagctc agaggtcttc gtgtccgcac acgagaccgc gatcaacgac        60
     ctcgtcacgg cgatctgcca gacgaggccg cacctgctgt cctacggctc gcccgcgttc       120
     gtcccggcct cggacgtcta cgacacgcag atgccaccga tcctcttccc gggcagcggc       180
     gggatcgagt ggcacgtccg gttctcgatc ccgcacctcg acctgttcga cgaggacagc       240
     ccgctgccgc cggagctgtc gctcgggccc gggcagttca gcctctcgac cacggtcgag       300
     ctctgcgtcg actgccgcaa gggcgggcgc cgcgacgacg gcgggaagga cgacggcggg       360
     aaggacgacg ggcacgacca cccggacgag cccaaccggg accggccgtg ggacgacaag       420
     cccagcaagg tcgagcaccc ggtctgcacc aagctcgacg tcttcgccgt cgggcacctc       480
     gtgggcacgt ccacggccgg cggaccggcc gtcgggttcg ccctcgacgc cgtcgagatc       540
     gtcgacatcc accccgacga gctcgagtcc gtcctcgagt gcctcctcgc ccagatgctg       600
     cgcgccgcac tcgcccaggt ccgccttccc gtctcggcgt tgcaggcggg cgccttcagc       660
     ctgaccccga ccgtcgggcc gctcatcgac accgacgtcg tcctcgcgcg cggaaacctc       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page