(data stored in ACNUC7421 zone)

EMBL: CP002343.PE298

CP002343.PE298       Location/Qualifiers
FT   CDS_pept        329692..330630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0305"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COGs: COG0294 Dihydropteroate synthase; InterPro
FT                   IPR000489: IPR006390; KEGG: pfr:PFREUD_02120
FT                   dihydropteroate synthase
FT                   ((2-amino-4-hydroxy-7,8-dihydropteridin-6-yl)methyl-
FT                   diphosphate:4-am inobenzoate
FT                   2-amino-4-hydroxydihydropteridine-6-methenyltransferase);
FT                   PFAM: dihydropteroate synthase DHPS; PRIAM: Dihydropteroate
FT                   synthase; SPTR: Dihydropteroate synthase
FT                   ((2-amino-4-hydroxy-7,
FT                   8-dihydropteridin-6-yl)methyl-diphosphate:4- aminobenzoate
FT                   2-amino-4-hydroxydihydropteridine-6- methenyltransferase);
FT                   TIGRFAM: dihydropteroate synthase; manually curated; PFAM:
FT                   Pterin binding enzyme; TIGRFAM: dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46860"
FT                   /db_xref="GOA:E6S7G5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G5"
FT                   /protein_id="ADU46860.1"
FT                   /translation="MSGLRPVDPVPAPPLVLRGRTFDAGRPAVMAIVNRTPDSFFGGNR
FT                   HADLDSAKRALEEALALGADIIDVGGVRAGQEGEPVDEDEEVRRVVPFLEWARRAHPDV
FT                   ILSLDTWRSGVALAAAGAGVDMVNDTWAGADPDLVRVAARLGAGYVISHTGGLPPRTDP
FT                   VAVTYGDDPLDVVRDVVTTLADGARAAELSGIPPERILVDPTLDFGKTTMHSLEVLRHT
FT                   ADVAALGYPVLQALSRKDFVGESLDVPVEDRLEGSLAATAVAAWLGATVFRAHDVRATR
FT                   RVVDMVATIRGDRPPVHARRGTPQTGSANSR"
     ctgtcggggc tccgcccggt cgacccggtc ccagcgccac cccttgtcct ccggggacgt        60
     accttcgacg ccggccgccc ggcggtgatg gcgatcgtca accggacccc ggacagcttc       120
     ttcggcggca accggcatgc cgacctcgac tccgcgaagc gcgccctgga ggaggcgctc       180
     gcgctcggcg ccgacatcat cgacgtcggc ggggtccggg ccggtcagga gggcgagccg       240
     gtcgacgagg acgaggaggt ccggcgcgtc gtgcccttcc tcgaatgggc tcgccgagcg       300
     cacccggacg tgatcctcag cctcgacacc tggcgctcag gcgtcgccct ggccgctgcg       360
     ggggccggtg tcgacatggt caacgacacg tgggccggcg cggacccgga cctcgtccgc       420
     gtcgcggccc ggctcggcgc cgggtacgtc atctcccaca ccggcgggct gcccccgcgc       480
     accgacccgg tcgcggtcac gtatggcgac gacccgctcg acgtcgtccg ggacgtcgtg       540
     accacgctgg ccgacggtgc ccgcgcggct gagctgagcg gcataccgcc ggagcggatc       600
     ctcgtcgacc cgacgctgga cttcggcaag acgaccatgc actcgctcga ggtgctccgg       660
     cacaccgccg acgtcgcagc tctcggctac ccggtgctcc aggcgctctc gcgcaaggac       720
     ttcgtcggcg agagcctcga cgtgcccgtc gaggaccgtc tcgaagggtc gctcgcggcg       780
     accgcggtcg cggcctggtt gggggccacc gtgttccggg cgcatgacgt ccgagcgact       840
     cgtcgggtgg tcgacatggt cgcgacgatt cggggcgatc ggcccccggt ccacgcgagg       900
     cgtgggaccc cccagaccgg ttccgcgaac tctcggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page