(data stored in SCRATCH zone)

EMBL: CP002343.PE3

CP002343.PE3         Location/Qualifiers
FT   CDS_pept        3881..5005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="COGs: COG1023 6-phosphogluconate dehydrogenase;
FT                   InterPro IPR006115: IPR006114: IPR004849: IPR006183; KEGG:
FT                   kse:Ksed_00030 6-phosphogluconate dehydrogenase
FT                   (decarboxylating); PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase
FT                   domain-containing protein; SPTR: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; TIGRFAM: 6-phosphogluconate
FT                   dehydrogenase, decarboxylating; manually curated; PFAM:
FT                   6-phosphogluconate dehydrogenase, C-terminal domain; NAD
FT                   binding domain of 6-phosphogluconate dehydrogenase;
FT                   TIGRFAM: 6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46565"
FT                   /db_xref="GOA:E6SDW2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW2"
FT                   /protein_id="ADU46565.1"
FT                   /translation="MQLGLIGLGRMGGNMRERLRRAGHEVVGYDRNPDVSDAASLEAMV
FT                   EGLSAPRVVWVMVPSGDPTRDTVARLAELLEPDDLVIDGGNSRFTDDFENAKLLAEKQI
FT                   GYVDCGVSGGIWGLENGYGLMCGGDARWIERAMPIFDALRPEGPREEGFVHAGEVGAGH
FT                   YAKMVHNGIEYGLMHAYAEGFELLEAKDIVKDVPGTFQAWSRGTVVRSWLLDLMVDALE
FT                   ENPHLDDVSDYTNDSGEGRWTVEEAIALGVPVPVISASLFARFASRQQVSPAMQAVSAL
FT                   RGQFGGHQVMTVAEGVALREGSVPAEPSKQAKVTHDEQSFDEKGKASARAFQEASRANV
FT                   ETAGEAVEAGAPPKTQRTDAVDTALGTERSKQAD"
     atgcagctcg gtctgatcgg tctcggcagg atgggtggca acatgcggga gcggctgcgc        60
     cgcgccgggc acgaggtggt cggctatgac cgcaacccgg acgtgtccga cgcagccagc       120
     ctggaggcca tggtcgaggg tctgagcgcc ccacgggtcg tgtgggtcat ggtgccgtca       180
     ggcgacccca cccgcgacac cgtggccagg ctggccgagt tgctcgagcc cgacgacctc       240
     gtcatcgacg gcggcaactc gcggttcacc gacgacttcg agaacgccaa gctcctcgcc       300
     gagaagcaga tcggctacgt cgactgcggg gtctccggcg gcatctgggg actcgagaac       360
     ggctacggcc tgatgtgcgg cggagacgcg aggtggatcg agcgcgcgat gccgatcttc       420
     gacgcgctgc gtcccgaggg gccgcgcgag gagggcttcg tccacgcggg cgaggtcggc       480
     gcgggccact acgcgaagat ggtccacaac ggcatcgagt acggcctgat gcacgcctac       540
     gccgagggct tcgagctgct cgaggcgaag gacatcgtca aggacgtccc cggcacgttc       600
     caggcctgga gtcgcggcac cgtcgtccgc tcctggctgc tggacctcat ggtggacgcc       660
     ctcgaggaga acccgcacct cgacgacgtg tccgactaca ccaacgactc cggcgagggc       720
     cgctggaccg tcgaggaggc catcgccctc ggcgtgcccg tgcccgtcat ctccgcctcc       780
     ctgttcgcca ggttcgcctc gagacagcag gtgtcgccgg cgatgcaggc ggtgtccgcg       840
     ctgcgcggcc agttcggcgg tcaccaggtg atgaccgtcg cggagggcgt cgccctgcgc       900
     gaggggtcgg tgccggccga gccgtcgaag caggccaagg tcacccacga cgagcagtcg       960
     ttcgacgaga agggaaaggc cagcgcgcgt gccttccagg aggcgtcccg ggccaacgtc      1020
     gagaccgcgg gtgaggccgt cgaggccggc gctcctccga agacccagcg caccgacgcg      1080
     gttgacaccg cgctcggcac ggagcgctcc aagcaagccg actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page