(data stored in ACNUC7421 zone)

EMBL: CP002343.PE302

CP002343.PE302       Location/Qualifiers
FT   CDS_pept        complement(334743..335240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_7098 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46864"
FT                   /db_xref="GOA:E6S7G9"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7G9"
FT                   /protein_id="ADU46864.1"
FT                   /translation="MSEHAPYDREETRGERLDRNFDEQLQEARIAQAGVQILFGFLLTL
FT                   PFQQRFETLTDFQRKIYLGTLLASAVAVVLFTAPVAVHRVLFRQGLKDFIVAYTSKLAS
FT                   VGLVALALSVVGGLVLVLDVLIAHTLAMWVGGAVAALTVVLWYLVPAARKRRVAPPEKP
FT                   ES"
     atgagcgagc acgccccgta cgaccgcgag gagacccgcg gtgaacgact cgaccgcaac        60
     ttcgacgagc agctgcagga ggcgcgcatc gcccaggcgg gtgtgcagat cctcttcggc       120
     ttcctcctca ccctgccgtt ccagcagcgg ttcgagacgc tcaccgactt ccagcggaag       180
     atctacctgg gcacgctcct cgcgtcggcc gtcgcggtgg tgctcttcac ggcaccggtg       240
     gccgtccacc gcgtgctctt ccggcagggg ctgaaggact tcatcgtcgc ctacacctca       300
     aagctcgcct ccgtcggcct cgtcgcgctc gccctgtcgg tggtcggtgg cctcgtgctc       360
     gtcctcgacg tgctcatcgc ccacacgctc gccatgtggg tcgggggagc ggtcgcggcg       420
     ctcaccgtgg tcctgtggta cctcgtgccc gccgcccgta agcggcgcgt cgcgccgccc       480
     gagaagcccg agagctag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page