(data stored in ACNUC7421 zone)

EMBL: CP002343.PE305

CP002343.PE305       Location/Qualifiers
FT   CDS_pept        338195..339394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0312"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: nml:Namu_0644 integrase family
FT                   protein; PFAM: integrase family protein; SPTR: Integrase;
FT                   PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46867"
FT                   /db_xref="GOA:E6S7H2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H2"
FT                   /protein_id="ADU46867.1"
FT                   /translation="MAGRRQKDSETHTTKYRGKDGRWHARVTVGRRIDGQLDRRHLQRK
FT                   TKRELDEAVRALERDRDAGKRTWLQGEQTLGGWLEHWITAILPLSVRWKTLSTYQSLMK
FT                   VHVIPKMGAARLADVRPEALELLYGQLLNEGRSAHVVHAVHRVLRSALGEAVRRHHLSQ
FT                   NPATVARPPRVATVEIDPLTSDECRSLLEAARGTPNAARWSVALALGLRQGEALGLSWD
FT                   DVDLDAGVIHVRRAVQRRTWQHGCGSKPGGQPACGHGRGGYCPQRRAGGLMLVELKTRA
FT                   SRRLIVLPGPLLSELQAHRSDQLRRQEERRGLWDGTHNLVFATDVGGLIDPARDFKDWK
FT                   NLLKAGGVRTVRLHDARHTAATLLLVQGVDLRTVMSIMGWTEMATAQRYVHAVSCLLCT
FT                   "
     atggccggta ggcgtcagaa ggactccgag acccacacga ccaagtaccg cggcaaggat        60
     ggccggtggc acgcacgagt cacggtcggc cgccggatcg acggtcagct cgatcggcgc       120
     catctgcagc gcaagaccaa gcgggagctc gatgaggcgg tgcgcgcctt ggagcgggac       180
     cgggacgcgg ggaagcggac ctggctccag ggcgagcaga cccttggcgg gtggctcgag       240
     cactggatca ccgcgatcct gccgctctct gtgcggtgga agacgctttc tacataccag       300
     agcctgatga aggtgcacgt catcccgaag atgggggcag cgcgcctcgc ggacgtccgt       360
     ccggaggcgc tcgagctcct gtacgggcag ttgttgaacg aagggcgttc agcccacgtg       420
     gtccatgccg tccaccgggt gcttcggtca gcgctgggcg aggcggtgcg gcgccaccac       480
     ctgagccaga acccggccac ggtcgcgcgt ccaccgcgcg tggccaccgt cgagatcgat       540
     cccttgacca gcgacgaatg ccgttctctg cttgaggcgg cacggggaac gccgaacgca       600
     gcccgctggt ccgtggcgct ggcactgggt cttcgacagg gcgaggcgct tggcctgtct       660
     tgggatgacg tggatctcga tgcgggtgtg atccacgttc ggcgtgctgt gcagcgacgg       720
     acctggcagc acggctgtgg aagtaagccc ggtggccagc cggcctgcgg tcacggacgc       780
     ggcggctact gcccgcagcg cagagcggga ggtctgatgc tggtcgagct gaagacccgc       840
     gcctcacgac ggctcatcgt cctaccgggg ccactgctat cggaacttca agcgcatcgc       900
     tccgatcagc tgcggcgcca ggaggaacgg cgaggcctat gggacggcac ccacaacctg       960
     gtattcgcga cggacgtggg tgggctcatc gaccccgcgc gagatttcaa ggactggaag      1020
     aacctcctga aggccggcgg cgtccgcacg gtccgcttgc acgacgcgag gcacaccgca      1080
     gcaaccctcc tcctcgtcca gggcgttgat ctgcgcaccg tgatgtccat catgggctgg      1140
     acagagatgg ccacggccca gcgatacgtc cacgccgtct catgcttgtt atgtacgtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page