(data stored in SCRATCH zone)

EMBL: CP002343.PE306

CP002343.PE306       Location/Qualifiers
FT   CDS_pept        339456..340529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0313"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: gbr:Gbro_4728
FT                   integrase family protein; PFAM: integrase family protein;
FT                   integrase domain protein SAM domain protein; SPTR: Putative
FT                   transposase; PFAM: Phage integrase, N-terminal SAM-like
FT                   domain; Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46868"
FT                   /db_xref="GOA:E6S7H3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H3"
FT                   /protein_id="ADU46868.1"
FT                   /translation="MSVLYPCLIRSRRPLGEVVVRVGVPLVDEYLEFLQGRCRPNTVVA
FT                   AAYDLRVFFGVVGKEPREVVPADVLGFITAQRTGRLEPGPVQAVVADGEPAGVATSTVA
FT                   RRLSSISGFFGYLQARGDVVVNPVPRGLPTRRERQRPSQGVPLTRRVWRLSRILTPAEV
FT                   DALTGALRTHRDRAMVAAMVLGGLRRCEVLGLRMGDVRVAERRLFIAEGKGGHQRLVPV
FT                   SSRFFTELASYLEAERPRATGTDRVFVVLRGPNRGNPLSVRGIDEVLAGARRRAGLAHA
FT                   TCHELRHTCLTRLREAGMALEAVQAQAQAGHDSIESTRIYLHLADDWLASQYRKAAEVI
FT                   DAQVFAGHPDGSGGSRR"
     atgtctgtct tgtatccgtg cctgatccgt tctcgtcggc cgttggggga ggtggtggtc        60
     cgcgtcgggg tgccgctggt ggacgagtat ctcgagttct tgcagggtcg gtgccggccg       120
     aacacggtgg tggcggcggc gtacgacctg agggtgttct tcggggttgt cggcaaggag       180
     ccgcgcgagg ttgtgccggc tgatgtgctt gggttcatca cggcccagcg gaccggccgc       240
     ctcgagccgg gcccggttca ggcggtggtg gccgacgggg agccggcggg ggtcgcgacg       300
     agcacggtcg ctcggcggct gtcgagcatc tcgggattct tcgggtacct gcaggcccgt       360
     ggggacgtgg tcgtgaaccc ggtgccgcgg ggcctgccga cgcgtcgtga gcgtcaacga       420
     ccgagccagg gtgtcccgtt gacgcgccga gtctggcggc tgtcgaggat cctgaccccg       480
     gccgaggtcg acgcgctgac cggcgcgctg cgcacccacc gggaccgggc gatggtcgcg       540
     gcgatggtgc tcggtgggct gcgtcgctgc gaggtccttg ggctgcggat gggcgacgtg       600
     cgggtggccg agcgtcggct gttcatcgcc gagggcaagg gcgggcacca acgcctcgtg       660
     ccggtgtcct cccggttctt cacggagctg gccagctatc tggaggcgga acgaccgcgc       720
     gccaccggca ccgaccgcgt gttcgtcgtc ctcaggggcc cgaaccgggg gaatcctttg       780
     agtgtcagag gaatcgacga ggtgctggct ggtgcgaggc ggcgggccgg gctggcgcac       840
     gcaacctgtc acgagctgcg gcacacctgc ctgacccggt tacgggaggc cgggatggcg       900
     ctcgaagccg tccaggccca ggcccaggcc gggcacgact cgatcgagtc gacccggatc       960
     tatctgcatc tggccgatga ctggctcgcc tcgcagtacc gcaaggccgc cgaggtcatc      1020
     gacgcgcagg tcttcgccgg ccacccggac ggcagcggcg ggagccggcg atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page