(data stored in ACNUC7421 zone)

EMBL: CP002343.PE309

CP002343.PE309       Location/Qualifiers
FT   CDS_pept        344369..344728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_4550 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46871"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7H6"
FT                   /protein_id="ADU46871.1"
FT                   /translation="MLVLVGTLLIVTTAAYRYAYGTWWQAPERIPYCGRTYIAVTPHLS
FT                   LADIRQRERQTSLPGDQPYAVVPIGKAPPIVGAEMLAAVTPVAQREKLGVPCAMGLYVK
FT                   TGDDQYTSYGITGGP"
     gtgctagtcc tcgtcggcac gctcctgata gtcacgactg ccgcctaccg ctatgcctac        60
     gggacctggt ggcaggcgcc agaacgcatc ccctactgtg gccggactta catcgcggtc       120
     acgccgcact tgagcctcgc agatattcgt caacgcgagc gccagacctc gttgcccggc       180
     gaccagccat acgccgtcgt acccatcggc aaggcgcccc ctatcgtcgg ggcggagatg       240
     ttggccgccg tcactcccgt ggcccaacgc gagaagttgg gtgtgccctg cgcgatgggg       300
     ctgtacgtca agacaggcga tgaccaatac acctcgtacg ggatcacagg cggcccgtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page