(data stored in ACNUC7421 zone)

EMBL: CP002343.PE31

CP002343.PE31        Location/Qualifiers
FT   CDS_pept        complement(33527..33979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0885 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46593"
FT                   /db_xref="GOA:E6SEJ2"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ2"
FT                   /protein_id="ADU46593.1"
FT                   /translation="MRLPVDDEIYNVNAVWLGPPNRTLPFRARYVAYAVGAVVFLLLQV
FT                   IERRLGIDLGFFSLAYSLLATVALTRLILSVVNPDRPLASVLGAFVHEVSAPRQESRVA
FT                   THTIRPARVRAVPARLSRAQRRLAKKSPAIAGVTATDLGDYQEVAT"
     atgcgacttc ctgttgatga cgagatctac aacgtcaacg ccgtctggct cggcccgccg        60
     aaccggaccc tacccttccg agcccggtac gtggcctacg ccgtcggcgc cgtggtgttc       120
     ctgctgctgc aggtcatcga gcgacggctc gggatcgacc tgggcttctt ctcactggcg       180
     tacagcctgc tcgcgacagt cgcgctcacg cggctgatcc tctccgtcgt caaccctgac       240
     aggcccctgg cctccgtcct cggagccttc gttcacgagg tctccgcgcc acgccaggag       300
     tcacgggttg cgacgcacac gatccgcccg gctcgggtgc gtgccgtccc cgcgcgcctg       360
     agccgggccc aacgccggct ggccaagaag agcccagcca tcgcaggcgt gacggccacc       420
     gatctcgggg actaccagga ggtggcgaca tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page