(data stored in ACNUC7421 zone)

EMBL: CP002343.PE313

CP002343.PE313       Location/Qualifiers
FT   CDS_pept        348317..348871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xce:Xcel_3427 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46875"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I0"
FT                   /protein_id="ADU46875.1"
FT                   /translation="MTSNARTGVIGLAIVAVLATGGCTDQGLPPATTSSPSATGTTPIT
FT                   TSTTMTAQDPELAAAEATVEKLWKLVDALGADKQRSLDELNTVARDQTLEIWRELLTKR
FT                   RREAIRQTGSTSIVSTEASSARGKLTVDTCFDVSKTNLLDTDGKSVVSENRASRVRYTS
FT                   VVERGSNGNYYVVQDKAVETC"
     atgaccagca acgcccgcac cggcgtcatc ggacttgcca tcgtggcggt cctcgcgacc        60
     ggcgggtgca ccgaccaagg tctgccgccc gccaccacct ccagcccctc ggcgaccggg       120
     acgacaccga tcaccacgag cacaaccatg acggcgcagg atcccgagct ggcggcggcg       180
     gaggcgaccg tggagaagct ctggaagctg gtcgacgccc tgggcgccga caagcagcgc       240
     agcctcgacg agctcaacac ggtcgcccgc gaccagactc tcgagatctg gcgcgagctg       300
     ctcacaaaga ggcggcggga agcgattcgc caaaccggca gcacctcaat cgtctctacg       360
     gaggcatcgt cggccagagg caagctcacc gtcgacacgt gcttcgacgt cagcaagacg       420
     aacctgctcg acacggacgg caagtccgtg gtctccgaga accgtgcctc acgagtgcgt       480
     tacacctccg tggtcgagcg cgggagcaac ggcaactact acgtcgtgca ggacaaggcg       540
     gtggagacat gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page