(data stored in ACNUC7421 zone)

EMBL: CP002343.PE315

CP002343.PE315       Location/Qualifiers
FT   CDS_pept        complement(351236..351670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0324"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="KEGG: mgi:Mflv_0689 transposase IS116/IS110/IS902
FT                   family protein; SPTR: Putative IS110 family transposase;
FT                   PFAM: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46877"
FT                   /db_xref="GOA:E6S7I2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I2"
FT                   /protein_id="ADU46877.1"
FT                   /translation="MEAYDGERVLEMVFIGVDPHKLSATIEVVDDRVLATGRFGTDRAG
FT                   YAAMRRHVAAYRERVWAVEGSNGAGRPLAQRLLADGEHVVDVRASLSRRARALDTGHNR
FT                   KTDAHDAHAVAVVAVRTTGLRVLAYDVELEALRMLVARSE"
     atggaggcct acgacggaga gcgggtgcta gagatggtgt tcatcggcgt cgatccccac        60
     aagctgtcgg cgaccatcga ggtcgtcgac gaccgagtgc tggccacggg ccggttcggc       120
     accgacaggg ccggctatgc cgcgatgcgc cggcacgtcg cggcctaccg ggagcgggtc       180
     tgggcggtcg agggcagcaa cggcgcgggc cggccgttgg cgcagcggct gctcgccgac       240
     ggcgagcacg tcgtcgacgt gcgggccagc ctcagccgcc gagcccgagc gctcgacacc       300
     ggccacaacc gcaagaccga cgcccacgac gcgcacgccg tcgccgtcgt cgcggtccgc       360
     accacggggc tacgagtcct ggcctacgac gtcgagctcg aggcgctgcg gatgctggtc       420
     gcccgaagtg agtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page