(data stored in ACNUC7421 zone)

EMBL: CP002343.PE317

CP002343.PE317       Location/Qualifiers
FT   CDS_pept        354072..354305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oaa:100084570 similar to Astacin-like
FT                   metallo-endopeptidase (M12 family)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46879"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I4"
FT                   /protein_id="ADU46879.1"
FT                   /translation="MRERRPLPIPTPYAAELAPSDTGVRSEVSLTHTPLRAGTPRGLTR
FT                   FAACLPRIQNQFARKPGCEASHRSSFVSSIRG"
     gtgcgcgagc gccggcccct ccccataccc acgccgtatg ccgccgagct ggctcccagt        60
     gacaccggcg tccgcagtga ggtgagcttg acccacacgc cgctgagggc agggactccg       120
     cgtggcttga cccgattcgc ggcatgcctc ccacggattc agaaccagtt cgcccgaaag       180
     cccgggtgtg aggcatctca caggtctagt ttcgtctcgt ccatcagggg gtga             234
//

If you have problems or comments...

PBIL Back to PBIL home page