(data stored in ACNUC7421 zone)

EMBL: CP002343.PE32

CP002343.PE32        Location/Qualifiers
FT   CDS_pept        complement(33984..34235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0884 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46594"
FT                   /db_xref="GOA:E6SEJ3"
FT                   /db_xref="UniProtKB/TrEMBL:E6SEJ3"
FT                   /protein_id="ADU46594.1"
FT                   /translation="MHTLETLATAAGTTGLQGWIKANIIPLLLLLIATMLFVLAQRGDN
FT                   AKAMRVVSGVIIALAVLGLATSGKADSLGSWMASLITG"
     atgcacacct tggagacgct cgcgaccgcc gcgggcacga ccggcctgca gggctggatc        60
     aaagcgaaca tcatcccgct gctgctcctg ctcatcgcga ccatgctgtt cgtgctcgcc       120
     cagcgaggcg acaacgccaa ggccatgcgg gtggtgtccg gcgtgatcat cgcgctggcc       180
     gtcctgggcc tggccaccag cggcaaggcc gacagtttgg ggtcctggat ggcctcgctc       240
     atcacggggt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page