(data stored in ACNUC7421 zone)

EMBL: CP002343.PE320

CP002343.PE320       Location/Qualifiers
FT   CDS_pept        complement(356600..357121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0330"
FT                   /product="C-type lectin domain protein"
FT                   /note="InterPro IPR001304; KEGG: plt:Plut_0367 VCBS; PFAM:
FT                   C-type lectin domain protein; SMART: C-type lectin domain
FT                   protein; SPTR: Putative uncharacterized protein; PFAM:
FT                   Lectin C-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46882"
FT                   /db_xref="GOA:E6S7I7"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I7"
FT                   /protein_id="ADU46882.1"
FT                   /translation="MTWHQARSAAAERTQGGPLCAGHLATITTADEQAFLFSTFGEGLH
FT                   TTWLGGYQTDGATEPAGGWTWITGETWGYTNWLLGEPNNSGGEDALAFLGTNGKWNDAP
FT                   ELYNYGASGGYVVEYEGRQVAMTSSPEATTTASTTTATVSSRWPSSPRPRSTRPRSTPP
FT                   RSLSMAPASK"
     atgacctggc accaggcccg ctccgcggcc gcggagcgta cgcagggtgg tccgctctgc        60
     gcaggccacc tcgccacgat cacgacggct gacgagcagg ccttcctctt cagcaccttc       120
     ggggagggtc tccacacgac gtggctgggc ggctaccaga cggacggcgc gaccgagcca       180
     gcgggtggct ggacgtggat caccggcgaa acctggggct acaccaactg gctcctgggc       240
     gagcccaaca actccggggg cgaggacgcc ctcgccttcc tgggcacaaa cggaaagtgg       300
     aacgacgcgc ccgagttgta caactacggc gcctcgggtg gctacgtcgt ggagtacgag       360
     ggccgtcagg tcgcgatgac atcaagcccg gaagcgacga caacagcatc aacgacgacg       420
     gcaacggtgt catcccggtg gccatcctca ccacggccgc gttcgacgcg tccacggtcg       480
     accccgccac ggtcgctctc gatggcgcca gcgtccaaat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page