(data stored in ACNUC7421 zone)

EMBL: CP002343.PE321

CP002343.PE321       Location/Qualifiers
FT   CDS_pept        357682..358581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0332"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="COGs: COG3386 Gluconolactonase; InterPro IPR013658:
FT                   IPR005511; KEGG: rer:RER_51080 lactone hydrolase; PFAM:
FT                   SMP-30/Gluconolaconase/LRE-like region-containing protein;
FT                   SPTR: SMP-30/Gluconolaconase/LRE domain protein; PFAM:
FT                   SMP-30/Gluconolaconase/LRE-like region"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46883"
FT                   /db_xref="GOA:E6S7I8"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7I8"
FT                   /protein_id="ADU46883.1"
FT                   /translation="MTERAVHSVISGMSYTECPRWHEGRLWFADFYTDAIYSVTEAGED
FT                   LRTEVEVPAQPSGLGWLPDGRLVFVSMKDRKVMRRESDGSVVVHADVTDAVTGHPNDMV
FT                   VDGEGRCWLGNFGFDLMGGADVETASLLRIDPDGSVTEVAHDLWFPNGSVVTGDGGTLI
FT                   VDETFGNRISAFTIQSDGRLGERRDWARFGDLPTSRVVAEAVPQAVLAPDGCCLDAEGC
FT                   LWVADAVGGRVCRVAEGGEILEEIMPGSGVFACMLGGSDGRTLFLSCAPDFDEHARSAA
FT                   REAEIRAVRVDVPHAGLP"
     atgaccgagc gggctgtcca cagcgtgatt tccgggatgt cctacaccga gtgcccacga        60
     tggcatgagg gccggctgtg gtttgccgat ttctacaccg atgcgatcta ttcggtgacc       120
     gaggcgggcg aggacttgcg taccgaagtc gaggtaccgg cccagccatc cggcctcggc       180
     tggctgccgg acggccggct ggtgttcgtg tcgatgaagg accgcaaggt tatgcgccgc       240
     gaatccgacg gcagcgttgt cgtgcatgcc gacgtcaccg atgccgtcac aggccatccg       300
     aacgacatgg tggtggacgg cgagggtcga tgctggctgg gcaacttcgg gttcgacctg       360
     atgggcgggg cagatgtgga gactgcgagc ctgctacgga tcgatcccga cggctccgtg       420
     accgaagtgg cacatgacct gtggtttccc aacggcagtg tggtcacggg cgacgggggc       480
     actctcatcg tcgatgagac gttcggaaac cgcatcagcg cgttcacgat ccagtccgat       540
     ggtcgactcg gcgagcgccg cgactgggcg aggttcggtg acctgcccac ctctcgggta       600
     gtcgccgagg cggtgccgca ggccgtccta gccccggatg ggtgttgcct cgatgcggaa       660
     gggtgcctct gggttgccga cgcggtcggc ggtcgtgtct gccgggtcgc cgaaggcggt       720
     gagatcctcg aggagatcat gccgggcagc ggggtgttcg cctgcatgct cggtggcagt       780
     gacgggcgca cccttttcct cagttgcgcg ccggatttcg acgagcacgc gcgcagcgcg       840
     gctcgcgaag cagagatccg agccgtgcgg gtggatgtgc cgcatgccgg tctaccctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page