(data stored in SCRATCH zone)

EMBL: CP002343.PE323

CP002343.PE323       Location/Qualifiers
FT   CDS_pept        359551..359928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0334"
FT                   /product="HEPN domain protein"
FT                   /note="InterPro IPR007842; KEGG: nca:Noca_3210 hypothetical
FT                   protein; PFAM: HEPN domain protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: HEPN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46885"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J0"
FT                   /protein_id="ADU46885.1"
FT                   /translation="MSALTQARDHLNKAREFLEAAEIDLDLEFFSAATSHAVIAGINSK
FT                   DAICLKLTGRTTKGDKHHEAVAELKPAGPEGADVAATMSRLLKLKTKAQYLAPAIGRKD
FT                   ASKAVEWATRMVEQAIAEVSR"
     atgagcgcgc tcacgcaagc tcgcgaccac ctgaacaagg cgcgagagtt cctcgaggcg        60
     gctgagattg acctggacct cgaattcttc tcagccgcga cctcccatgc tgttatcgcc       120
     ggtatcaact cgaaggacgc catctgcctc aagttgaccg ggcgcaccac gaagggcgat       180
     aagcatcacg aggccgtcgc ggagctgaag ccggcaggcc cggaaggcgc cgacgtggcc       240
     gcgacgatga gccgcctgct gaagttgaag acgaaggccc agtacctcgc gcccgcgatt       300
     ggcagaaagg atgcaagtaa ggcggtcgag tgggccacgc gcatggtcga gcaggcgata       360
     gccgaggtga gccgctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page