(data stored in ACNUC7421 zone)

EMBL: CP002343.PE325

CP002343.PE325       Location/Qualifiers
FT   CDS_pept        complement(361065..362834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0336"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG3284 Transcriptional activator of
FT                   acetoin/glycerol metabolism; InterPro IPR002078: IPR003018:
FT                   IPR002197; KEGG: sma:SAV_1392 transcriptional regulator;
FT                   PFAM: sigma-54 factor interaction domain-containing
FT                   protein; GAF domain protein; helix-turn-helix Fis-type;
FT                   SPTR: Putative transcriptional regulator; PFAM: Bacterial
FT                   regulatory protein, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46887"
FT                   /db_xref="GOA:E6S7J2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J2"
FT                   /protein_id="ADU46887.1"
FT                   /translation="MADSAMEVAREQYLAAQGRSSTVRPMVIASWQRSIGHQVNMTRLD
FT                   APFVEDPDLDTPLVKAASPILEALHEQLANEPVATMLTDKSGLVLERRVTHEGLTTRLN
FT                   HVSLAPGHVYAEEFVGTNGIGTALASARPTVISGPEHYVEELRFFHCAAVPILHPTRRV
FT                   ALGAFNLTATVASGSGSMALALAASTARQIERELALISSQREYVLFERYLETCRAIRHT
FT                   PVLAFNADVVMMNDRLRASITGGDQTALLSHAREIAQDGSLADGRTLILPSGLVVEIRR
FT                   SPVGNDEAQEAGEVLQVRLVGRPRSSVRAHPPRRISGLVGSDPAWVKSVAEAEAAYRAR
FT                   SWICIFGEAGAGKVHLIGAIHRAHGGTPPLVLDPPVEESPETECAWVASLALSVTDPEN
FT                   VVIVRNAHWMSARLRTLVVDQLSLRSPANSARIVLTAQASAVAPEDELVTLCGTHIDIP
FT                   PLRHRHDDVLALIRFFLRRYRPHEDLHLSPATEHALQRYPWPENVRQLEQTVRLLSRRH
FT                   TKSTIEPTDLPPEFRVQGRSKLTTLEEVERDAILKGLVEHDRNVLQTARDLGISRATIY
FT                   RKMRRYGIDTTRL"
     atggccgatt cagccatgga ggtcgcgcgc gagcagtacc tcgccgctca ggggagatct        60
     tccaccgtac ggccgatggt gatcgcctca tggcagcgtt cgatcggcca ccaggtgaac       120
     atgacacgac ttgacgcacc cttcgtcgag gacccggacc tcgacacccc gctggtcaag       180
     gcggcctccc cgatcctcga ggcgctgcac gagcagctgg ccaacgagcc tgtcgccacc       240
     atgctcaccg acaagagcgg cctcgtgctc gagcgcaggg tcacgcacga gggcctcacg       300
     acccggctga accacgtcag cctcgcgccc gggcatgtgt acgcggagga gtttgtcggc       360
     accaacggca tcggcaccgc cctcgcgagc gcgaggccga ccgtcatcag cgggcctgag       420
     cactacgtgg aggagctccg gttcttccac tgtgccgcgg tgccgatcct ccaccccacc       480
     cgcagggtcg cgcttggggc cttcaacctc actgccaccg tcgcctcggg ctctgggagc       540
     atggcactgg ccctggccgc ctccacggcc cgccagatcg agcgcgagct cgcgctcatc       600
     tcatcccagc gcgagtacgt cctgttcgag cgctacctgg agacgtgtag ggcgatccgc       660
     cacacgccgg tgctcgcctt caacgcggat gttgtgatga tgaacgaccg tctccgggcc       720
     tcgatcaccg gcggggacca gaccgctttg ctctcgcacg cccgagagat cgcgcaggac       780
     ggaagcctgg ccgatggcag gacgctcatc ctcccgtcgg gactcgtcgt cgagatccgg       840
     cgttcgcccg ttgggaacga cgaggcccag gaagccggtg aggtgctcca ggtgcgtctc       900
     gtgggccgtc cccgcagctc agtgagggcc cacccgcccc ggcgcatctc gggtctggtc       960
     ggctctgacc cggcgtgggt gaagtccgtc gccgaggcgg aggccgccta ccgggcacgc      1020
     tcctggatct gcatcttcgg ggaggcgggc gcggggaagg tccatctcat cggagcgatt      1080
     catcgcgccc acgggggcac ccccccgctg gtgctcgacc cgccggttga ggaaagcccg      1140
     gagaccgagt gcgcttgggt cgcctcgctc gcgctcagcg tcaccgaccc ggagaacgtg      1200
     gtcatcgtgc gcaacgccca ctggatgagc gcccgcctgc gcactctcgt cgtcgaccag      1260
     ctcagtctcc gctcgccggc gaactctgcc cggatcgtcc tgaccgcgca ggcgtccgcc      1320
     gtggcgccgg aggacgagct ggtgacgttg tgcggcaccc acatcgacat tccgcccctg      1380
     cgtcaccgac acgatgacgt cctggccctg atccgcttct tcctcaggcg gtatcgcccg      1440
     cacgaggacc tccacctctc gcccgccacc gagcacgccc tgcagcgcta tccatggccg      1500
     gagaacgtcc ggcagctcga gcagaccgtc cggttgctca gcaggcggca taccaagagc      1560
     acgatcgagc cgaccgacct cccgccggag ttccgagtgc aggggcgcag caagctcacg      1620
     acgctggagg aggtggagcg cgacgccata ctcaagggac tcgtcgaaca tgatcgcaac      1680
     gtgctccaga cggcccggga cctcgggatc tcgcgagcga cgatctaccg gaagatgcga      1740
     aggtacggca tcgacacgac gcgcctctga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page