(data stored in SCRATCH zone)

EMBL: CP002343.PE326

CP002343.PE326       Location/Qualifiers
FT   CDS_pept        363033..364058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0337"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterPro IPR013154: IPR013149: IPR002328; KEGG:
FT                   sma:SAV_1393 alcohol dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; SPTR: Putative alcohol
FT                   dehydrogenase; PFAM: Alcohol dehydrogenase GroES-like
FT                   domain; Zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46888"
FT                   /db_xref="GOA:E6S7J3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6S7J3"
FT                   /protein_id="ADU46888.1"
FT                   /translation="MKAVRLVGYEQQPQLMDVPDPTPSSPLDVVIRIGGAGVCRTDLHI
FT                   IEGQWEEKSGVALPYTIGHENAGWVEAVGSAVTNVKPGDPVILHPLATCGLCRACRAGD
FT                   DVHCVNSSFPGIDSDGGYAEYLRTTARSVVRLDDSLEPADVAALADAGLTAYHAVAKAA
FT                   RVLRPGDTAVAIGAGGLGHIGIQVFKALSPARLVVVDRSPEALELASELGADVTLRADG
FT                   TQVEAIQELTQGNGAEAILDFVGEGGAVEDGVQMLRRAGNYYVIGYGGEIRVPTIDVIS
FT                   TEINFIGNLVGSYNDLVELMVLAAEDRVRLHTQRYALSDFQKALDDLDAGLVRGRAILV
FT                   P"
     gtgaaggcag tcaggctcgt cgggtacgag cagcagcccc agttgatgga cgtcccggac        60
     ccgaccccga gcagcccgct cgatgtcgtg atacgcatcg gcggtgccgg cgtgtgccgc       120
     accgacctgc acatcatcga gggccagtgg gaggagaagt cgggagtcgc cctcccatac       180
     acgatcggac acgagaacgc cggctgggtc gaggccgtcg ggtcggccgt cacgaacgtc       240
     aagccggggg acccggtgat cctccaccca ctggccacct gcggcctctg ccgcgcctgc       300
     cgagccgggg acgacgtgca ttgcgtcaac tcgtccttcc ccgggatcga cagcgacggt       360
     gggtatgccg agtacctgcg caccacagcc cgctcggtcg tccggcttga cgactccctc       420
     gagccggcgg acgtcgcggc gctcgcggat gccggcctca cggcatacca cgccgtggct       480
     aaggccgcgc gcgtcctgcg gcccggtgac acggccgttg ccattggtgc cggcgggctt       540
     ggccacatcg gcatccaggt cttcaaggcc ctctcgccgg cacgactggt cgtcgtcgac       600
     cggtcgccgg aggcgctcga gctcgcgagc gagctcggtg ccgacgtgac cctgcgcgcc       660
     gacggcaccc aggtcgaagc catccaggag ctcacccaag gcaatggcgc cgaggccatc       720
     cttgacttcg tcggggaagg gggcgctgtt gaggacgggg tccagatgct gcgccgcgcc       780
     ggaaactact acgtcattgg ctacggcggc gagatccgcg ttcccaccat cgacgtgatc       840
     tccaccgaga tcaacttcat cggcaatctc gtggggtcgt acaacgacct cgtcgagttg       900
     atggtcctcg cagcggagga ccgggttcgc ctgcacaccc agcgctacgc gctgtccgac       960
     ttccagaagg ccttggacga cctcgacgcg ggcctggtcc gcggccgggc gattctcgtc      1020
     ccgtga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page